KEGG   Moraxella catarrhalis RH4: MCR_0820Help
Entry
MCR_0820          CDS       T01224                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mct  Moraxella catarrhalis RH4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCR_0820
   01230 Biosynthesis of amino acids
    MCR_0820
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCR_0820
  Energy metabolism
   00680 Methane metabolism
    MCR_0820
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCR_0820
Enzymes [BR:mct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MCR_0820
Exosome [BR:mct04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MCR_0820
  Exosomal proteins of melanoma cells
   MCR_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827104..827685
Genome map
AA seq 193 aa AA seqDB search
MTTVYFIRHAEPNYANRDEFSRDLTPKGIAQSERLLDVFRGIDIDVFFSSPYKRAVDTIY
PLANSRKKNIHLKEKLCERRIGTWVDNFDEFSQKQWQDFGFHLKNGESLHRVQQRNIAML
HEILINYPNQTIVIGTHGTALSTIIKYYQADFGYQDFNANKHKFPWIMAFEFDGIMLKRY
HEIIHEIHMDDMP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagtttattttattcgccatgctgaacccaattatgccaatcgtgatgagttt
agccgagacttgaccccaaaaggcattgcccaaagcgagcggttgcttgatgtgtttagg
ggtattgatattgatgtgtttttttcaagcccttacaaacgggcggtggatacgatttat
ccgcttgccaacagtcgcaaaaaaaacattcatctaaaagagaagctttgtgaaaggcgg
attggcacttgggtggataattttgatgaatttagccaaaagcagtggcaagattttgga
tttcatctaaaaaatggtgaaagtttgcaccgtgtccagcaacgaaacattgctatgttg
catgaaattttgataaattatcccaatcagacgattgtcatcggcacgcacggtacggca
ttatctaccatcattaagtattatcaggcggattttggttatcaggattttaatgccaat
aagcacaaatttccgtggataatggcatttgaatttgacggtattatgctaaaacgctac
cacgaaattatccatgaaatccacatggacgatatgccatga

DBGET integrated database retrieval system