KEGG   Moraxella catarrhalis RH4: MCR_0820Help
Entry
MCR_0820          CDS       T01224                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mct  Moraxella catarrhalis RH4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCR_0820
   01230 Biosynthesis of amino acids
    MCR_0820
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCR_0820
  Energy metabolism
   00680 Methane metabolism
    MCR_0820
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCR_0820
Enzymes [BR:mct01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MCR_0820
Exosome [BR:mct04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MCR_0820
  Exosomal proteins of melanoma cells
   MCR_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827104..827685
Genome map
AA seq 193 aa AA seqDB search
MTTVYFIRHAEPNYANRDEFSRDLTPKGIAQSERLLDVFRGIDIDVFFSSPYKRAVDTIY
PLANSRKKNIHLKEKLCERRIGTWVDNFDEFSQKQWQDFGFHLKNGESLHRVQQRNIAML
HEILINYPNQTIVIGTHGTALSTIIKYYQADFGYQDFNANKHKFPWIMAFEFDGIMLKRY
HEIIHEIHMDDMP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagtttattttattcgccatgctgaacccaattatgccaatcgtgatgagttt
agccgagacttgaccccaaaaggcattgcccaaagcgagcggttgcttgatgtgtttagg
ggtattgatattgatgtgtttttttcaagcccttacaaacgggcggtggatacgatttat
ccgcttgccaacagtcgcaaaaaaaacattcatctaaaagagaagctttgtgaaaggcgg
attggcacttgggtggataattttgatgaatttagccaaaagcagtggcaagattttgga
tttcatctaaaaaatggtgaaagtttgcaccgtgtccagcaacgaaacattgctatgttg
catgaaattttgataaattatcccaatcagacgattgtcatcggcacgcacggtacggca
ttatctaccatcattaagtattatcaggcggattttggttatcaggattttaatgccaat
aagcacaaatttccgtggataatggcatttgaatttgacggtattatgctaaaacgctac
cacgaaattatccatgaaatccacatggacgatatgccatga

DBGET integrated database retrieval system