KEGG   Moraxella catarrhalis: MCR_0891Help
Entry
MCR_0891          CDS       T01224                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mct  Moraxella catarrhalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCR_0891
Enzymes [BR:mct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MCR_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
894582..895013
Genome map
AA seq 143 aa AA seqDB search
MSKQAYANAIVIALGSNHDAKVAFTCAIKSLQELGRVVLSQRICGQDFTGRSQRIYHNAC
AYIILTKTMQYTDIEQTLKQIERRCGRNPAKKCTKYDYEVVIDLDILAARFDEQWQMNLA
RLPLKNHDIQGIKQVAAFLLDQI
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaagcctatgcaaatgcgattgttatcgctttgggcagtaaccatgatgcc
aaggttgcgtttacttgtgccattaaatcgcttcaagagcttgggcgagtcgtattatca
cagcgaatttgtgggcaagatttcactgggcgtagtcagagaatttatcataatgcttgt
gcttatattatactgacaaaaactatgcaatatacagacattgaacaaacgctgaaacaa
attgaacggcgatgtggacgcaatcctgccaaaaaatgtaccaaatacgattatgaagtg
gtgatagatttggatattctggcggcaaggtttgatgaacagtggcagatgaatttggca
cgactgccactaaaaaaccacgatatacaaggcataaagcaagttgcggcatttttatta
gaccaaatatag

  All links  
No link information was found.   
DBGET integrated database retrieval system