KEGG   Moraxella catarrhalis BBH18: MCR_1425Help
Entry
MCR_1425          CDS       T01224                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCR_1425 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCR_1425 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCR_1425 (trpA)
Enzymes [BR:mct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCR_1425 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1416894..1417736)
Genome map
AA seq 280 aa AA seqDB search
MKTRIEMTFETLRQAGKKALIPYIMAGDPCPDVTVDLMHKLVEHGADIIEVGLPFSDPMA
DGPIIAHAAERALAAGVSTRDALNMIAKFRQTNQTTPVLVMGYLNPVEIIGYDNFANLCA
DAGVDAILMVDLPPNEADGYAKSLTERTDHPMNQIFLLAPTTKSDRRTKVIENCSGFIYY
VSLKGVTGSGALDVAAVREQVAKIKQQTTIPVCVGFGIRDGDSAKALGAVADGIIVGSEL
VKHFADCGHDEQKIQQAKAGLLNKMDELRKSLDELTSSTN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagaattgaaatgacttttgagacattgcgtcaagcgggcaaaaaagccctg
attccttatattatggcaggcgatccatgtcctgatgtgacggttgatttaatgcataag
cttgttgagcatggtgcggatattattgaggtggggttgccttttagcgacccgatggca
gatggtcccatcattgcccatgctgccgaaagagcattggcggcaggcgttagcactcgt
gatgcactaaatatgattgctaaatttcgtcaaaccaaccaaacaacgcctgttttagtc
atgggttatttaaaccctgttgaaatcattggttatgataattttgctaatttgtgtgct
gatgctggcgttgatgcaattttgatggtggatttaccgcccaacgaagcagatggctat
gcaaaatcactgaccgagcgtaccgatcatcccatgaatcaaatttttttgctggcacca
accacaaaatcagatcgccgtaccaaggttatcgaaaactgtagtgggtttatttattat
gtatcactcaaaggtgtcacaggttcaggcgcgcttgatgtcgcagccgtgcgtgagcag
gtagcaaaaattaagcaacaaaccacaatacctgtgtgtgtgggctttgggattcgtgat
ggtgattcagccaaggcattgggtgcggttgctgatggcatcattgttgggtctgaattg
gtcaagcattttgctgattgtggtcatgatgaacaaaaaattcagcaagccaaggctggg
ttattaaacaaaatggatgagcttagaaaatcacttgacgagcttacatcaagtaccaat
taa

DBGET integrated database retrieval system