KEGG   Moraxella catarrhalis BBH18: MCR_1426Help
Entry
MCR_1426          CDS       T01224                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mct  Moraxella catarrhalis BBH18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCR_1426 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCR_1426 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCR_1426 (trpB)
Enzymes [BR:mct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCR_1426 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1417779..1418993)
Genome map
AA seq 404 aa AA seqDB search
MTTQFKFGQYPDINGYFGRHGGRFVSETLMAALEELDEIYQTAKADPKFWDEFMADLTDY
VGRPTPLYFAERLTQQVGGAQIFFKREDLNHTGAHKVNNTIGQALLAKMVGKKRIIAETG
AGQHGVATATIAARLGLECVVYMGADDVERQKMNVYRMRLLGATVVPVTSGSRTLKDAMN
EAMRDWVANVDTTYYIIGTVAGPHPYPMLVRDFQAIIGREARIQHLQKTGRLPDALVACV
GGGSNAIGLFYDFLNDHEVVMYGVEANGLGIDTPNHAAPLQAGRVGVLHGNRTYLMADDD
GQILGTHSISAGLDYPGVGPEHSFLKDIERVHYVGVTDDEALHAFKEVTSKEGIIPALES
SHAVAYGLKLAATMKPEQSMIINMSGRGDKDLHTVMAKDGMQID
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaatttaagtttggacaatatcctgatatcaatggatattttggtagacac
ggtggtcgttttgtgtccgaaactttgatggcggcgcttgaagagcttgacgaaatttat
caaactgccaaagctgaccctaagttttgggatgaatttatggcggatttaacggactat
gttggtcgtccgacaccgctatattttgctgaacgcttgacccaacaagttggtggcgct
cagattttttttaagcgtgaggatttaaaccatacaggtgcccataaagtcaataatacc
atcggtcaagcattgctcgccaaaatggtgggcaaaaaacgcattatcgctgaaacaggt
gcaggacaacatggcgttgcaaccgctaccattgccgcacgccttggcttggaatgcgtg
gtttatatgggtgcagatgatgttgagcgtcaaaagatgaatgtatatcgcatgcgcctt
ttgggggcaactgttgtgcctgttacttcaggttctcgcaccttaaaagatgccatgaat
gaggcgatgcgtgattgggtggcaaatgttgacaccacttattatatcattggtacagtc
gcaggcccgcacccatatccgatgcttgtgcgtgattttcaggcgattattggtcgtgag
gcacgcatacaacatttacaaaaaacaggccgcttgcctgatgcattggttgcatgtgtt
ggtggcggttccaatgccattgggctattttacgattttttaaatgatcatgaggtggtg
atgtatggtgtggaagccaatgggttaggcattgatacacccaatcacgccgctcctttg
caggctgggcgtgtcggtgtattgcacggcaaccgaacttatctaatggcagatgatgat
ggtcaaattctaggtacgcattcgatttcggcaggtttagattatccaggtgttggccct
gaacacagctttttaaaagatattgagcgtgttcattatgtcggtgtaacggatgacgag
gcattacacgcctttaaagaagtgacttcaaaggagggtatcattccagcacttgaaagc
tcacatgcggtagcttatgggctaaaattggcggcgaccatgaagcctgagcaatcaatg
attattaatatgtcaggtcgtggtgataaagatttacatacggttatggcaaaagatggc
atgcaaattgattaa

DBGET integrated database retrieval system