KEGG   Moraxella catarrhalis RH4: MCR_1772Help
Entry
MCR_1772          CDS       T01224                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mct  Moraxella catarrhalis RH4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCR_1772 (tpiA)
   01230 Biosynthesis of amino acids
    MCR_1772 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCR_1772 (tpiA)
   00051 Fructose and mannose metabolism
    MCR_1772 (tpiA)
   00562 Inositol phosphate metabolism
    MCR_1772 (tpiA)
Enzymes [BR:mct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCR_1772 (tpiA)
Exosome [BR:mct04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCR_1772 (tpiA)
  Exosomal proteins of bladder cancer cells
   MCR_1772 (tpiA)
  Exosomal proteins of melanoma cells
   MCR_1772 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741601..1742353)
Genome map
AA seq 250 aa AA seqDB search
MNVQRCVIGNWKLNPATKSAAHELAQGLSGIACDAVRVGCTPSFTHVSTVAGVLAGTPIW
VGAQDICAYTQSTGAYTGDVSAEQLSDLGVGFVIIGHSERRNYYREDHSLLVEKMKHAFA
ADLSVVFCIGETKEQYQDNQTLSVLDGQLSVLQTFRVPRGKLIIAYEPIWAIGTGLTPST
QEVIATHAHIKSVLASYHFEGVSVLYGGSVNEQNAAEFAQAEGVDGALVGGASLKLDTFA
QIIAAFESAS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacaaagatgcgtcatcggcaattggaaattaaacccagcaaccaagtcggcg
gcacatgagctggcacagggcttgagtggtatagcctgtgatgcggtcagggttggctgt
acaccaagttttacccatgtatcgactgtggcaggtgtattggcaggtacaccgatttgg
gtgggtgctcaagatatttgtgcatatacccaaagtacgggggcgtatacgggtgatgtg
tctgctgagcagctgagtgatttgggcgtaggctttgtcattattgggcattctgagcgt
cgcaactattatcgtgaagatcacagcttattggttgagaaaatgaagcacgcatttgct
gcagatttgagcgttgtgttttgtattggtgagaccaaagagcaatatcaagacaatcag
accttatcagtacttgatggtcagttatcggtattacaaacctttcgtgtgccacggggc
aagcttatcattgcttatgaacctatttgggcgattggcacaggtctgacacccagcact
caagaagtcatcgcaacccatgcgcatattaagtcagtcttagcatcgtatcactttgaa
ggcgtcagtgtgctttatggtggctcggtgaatgagcaaaatgctgctgaatttgctcaa
gctgaaggtgttgatggggcattggtcggaggtgcttctttaaaattggatacctttgca
cagattattgctgcatttgagtcagcatcgtag

DBGET integrated database retrieval system