KEGG   Moraxella catarrhalis RH4: MCR_1809Help
Entry
MCR_1809          CDS       T01224                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mct  Moraxella catarrhalis RH4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MCR_1809 (galU)
   00052 Galactose metabolism
    MCR_1809 (galU)
   00500 Starch and sucrose metabolism
    MCR_1809 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MCR_1809 (galU)
Enzymes [BR:mct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MCR_1809 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1777014..1777886)
Genome map
AA seq 290 aa AA seqDB search
MIMNTITHAIIPTAGFGTRMLPLSKAVPKELLPLGDKPAIHYVVMEAVRAGIKTIVLVNH
AQKQAIENYFDINTELDSQLRQKGKDGLADGLNFLPKDVRIVSVRQGYPLGLGHAVLQGR
AVVGDNPFVVLLPDVVLDPFTTDFRADNLAYMMTRFAQTGRSQILVEPVADSQVHKYGIA
RLKDRQSVQKSDANHPFDVLGFVEKPSLDLAPSNLAVVGRYVFSPEIFEYLAKTKPSVGG
EIQLTDAIDALISQQGMDVVTIKGASFDAGDMTSYIQAFAYFASQVDQSF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaacaccattacccatgccatcattcccaccgcaggctttggtactcgtatg
ctgcctttatcaaaagctgtacccaaagagctgttgccactgggtgataaacctgctatt
cattatgtggttatggaggcggtgcgtgcgggcattaaaaccattgtgttggtcaatcat
gctcaaaagcaggcgattgaaaactattttgatatcaataccgaacttgatagccagtta
cgccaaaaaggcaaagatggcttggcagatggcctaaactttttacccaaagatgtacgc
attgtcagtgtgcgtcaaggttatccgttggggcttggtcatgcagtgctacaagggcgt
gctgtggtgggcgataatccatttgttgtgctgttgcctgatgtcgtgctagatccattt
acgacagattttagggcagataacttggcatatatgatgacaagatttgcccaaactggc
cgcagtcaaattttggttgaacctgtggcagatagtcaggtgcataaatatggcattgct
cggctaaaggatcggcaaagtgtacaaaaatcggatgctaatcacccatttgatgtactg
ggttttgtcgaaaaaccaagtttggatcttgcaccgtctaatcttgctgtggtggggcgg
tatgtatttagccctgaaatttttgagtatttggcaaaaaccaagccaagtgtaggcggt
gagattcagctcaccgatgccatcgatgcactcatcagccagcagggtatggatgtggta
acaataaaaggggcaagctttgacgctggtgatatgacaagctatattcaggcatttgct
tattttgccagtcaagtcgatcagtcgttttaa

DBGET integrated database retrieval system