KEGG   Moraxella catarrhalis: MCR_1835Help
Entry
MCR_1835          CDS       T01224                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mct  Moraxella catarrhalis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mct00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1800704..1801192)
Genome map
AA seq 162 aa AA seqDB search
MTTCFIGLGGNITNELGTPTEHIINAVQAFKQSPHFTDVKMSSLYQSKAFGITDQPDFIN
AVLSANTSLPPLELLDFCQGLEQTAKRVRLRHWGERSLDVDILLYGDKRIHHERLTVPHQ
GLFERNFVLIPMLEIDECLLVNGQKLADLNESNSWQGLNKLT
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttgttttattggacttggtggcaacattaccaatgaacttggcactcccacc
gagcatatcatcaacgccgtacaagccttcaaacagtcgccacattttaccgatgtgaaa
atgtcatcactgtatcaatccaaagcctttggcatcaccgaccaacctgattttattaat
gcggtattaagtgccaataccagcttaccaccgcttgagttgcttgatttttgtcaaggt
cttgaacagaccgccaaaagagtgcgattgcgtcattggggtgagcggtctttggatgtg
gatattttgttatatggtgataaacgcattcatcatgaacggctgaccgtgccacatcaa
ggcttatttgaacgaaattttgtgttaattccaatgcttgaaattgatgagtgtttgctg
gttaatgggcaaaaattggcggatttaaatgaaagtaacagctggcaaggtttgaataaa
ctgacataa

DBGET integrated database retrieval system