KEGG   Moraxella catarrhalis: MCR_1882Help
Entry
MCR_1882          CDS       T01224                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mct  Moraxella catarrhalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mct01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mct00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1842537..1843469)
Genome map
AA seq 310 aa AA seqDB search
MTNKPTVALIGAPTDVGAGVRGVNLGPDALRIADIDKAIEQYGFTVIDRGNLQGPANPNQ
PPVNGYRHFDEVVAWNKMAHDAVYDELKNGNFPILMGGDHCLGLASLTAVARHCREQGKK
LRILWLDAHADFNTSEMTPSGNIHGMPVACACGFGPDELTTIGGVRGAISPKDVYQIGIR
SVDAKEKYFINEKGVTVFDMRYIDENGMRHTMEQALKGLDNDTHLHISFDVDFLDPSIAP
AVGTTVMGGPTYREASLCMEMIADTGLMASLDIMELNPTLDERNRTAVIMVDFIESLFGK
STLVRPDTTQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaaacctaccgttgcgttaataggtgccccaaccgatgtgggtgcaggtgtg
cgaggcgtgaacttagggcctgatgccttacgcattgctgacattgataaagccattgaa
caatatggttttactgtcattgaccgtggtaatttgcaaggcccagccaaccccaatcag
ccccctgtgaacggctaccgtcattttgatgaagtggttgcatggaacaaaatggcacac
gatgctgtgtatgatgagctgaaaaatggcaactttcccattttgatggggggcgaccat
tgtttaggtttggcatcattgaccgctgtggcacgccattgccgtgagcaaggcaaaaag
ttgcgtatcctttggcttgatgctcatgctgattttaataccagcgaaatgaccccatca
ggcaacattcatggcatgcctgtggcttgtgcttgtggttttggtcctgatgagttaacc
accattggcggtgtcagaggagcgattagcccaaaagatgtgtatcaaatcggtatccgc
agtgtggacgctaaagaaaaatacttcatcaacgaaaaaggcgtcactgtctttgacatg
cgttatattgatgaaaatggcatgcgtcataccatggaacaagcgttaaaaggcttggat
aatgacacgcacttacacatcagttttgatgtggattttcttgacccaagcatcgcccca
gcggttggcacaacggtgatgggcgggcctacctatcgtgaagcgtcattgtgtatggag
atgattgccgatactggtttgatggcatctttggacatcatggagctaaacccaaccctt
gatgaacgcaaccgcaccgcagtcatcatggtggattttattgaatccttgtttggtaaa
tccaccctagtcagacctgacacaacccaataa

DBGET integrated database retrieval system