KEGG   Mobiluncus curtisii: HMPREF0573_10003Help
Entry
HMPREF0573_10003  CDS       T01257                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0573_10003 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0573_10003 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0573_10003 (trpB)
Enzymes [BR:mcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0573_10003 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
8089..9321
Genome map
AA seq 410 aa AA seqDB search
MNKYRDFDNYLKEYPDEKGYFGKYGGNYLQDPELVKAFDQYAEAYQTIAQSAQFIAELRR
IRKDFQGRPTPVYHCQRLSQKLGRTQIYLKREDLNHTGAHKLNHCMGEGLLAKYMGKKKL
IAETGAGQHGVALATAAAYFGLECDIYMGEVDIAKEAPNVARMKVLGARVIPVSFGLKTL
KEAVDAAFMAYSEEYHDAIYCIGTAAGPHPFPVMVRDFQEVVGVEARAQFLEQTGHLPDK
IMACVGGGSNAIGLFVPFLADPVEIYGVEPQGRGTALGDHAATLTYGGEGVMHGFNSIML
SDEKGNPAPVYSNASGLDYPSVGPEHSLLHDMERVNYVTIRDEEAIEALFLLSRLEGIIP
AIESSHALAYAIKEARKGKPGSILVNLSGRGDKDLDFVIEHYGTGEDYVK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatatcgcgattttgacaactatctcaaagaataccccgacgaaaagggatac
ttcggcaaatacggtggcaactacctgcaggaccccgagctggtcaaagcctttgaccag
tacgccgaggcctaccagacaattgcacagtctgctcagtttattgccgaactgcgccgc
atccgcaaggacttccaaggtcgccccactccggtgtaccactgccagcgtctgagccag
aaactgggtcgcacccagatttatttgaagcgcgaggacttgaaccataccggagcgcac
aagctcaatcactgcatgggtgaaggtctgttggcgaaatacatgggtaaaaagaagctc
atcgcggaaactggagcaggtcagcacggtgtagctctcgccaccgccgccgcctatttc
ggcctggagtgcgacatctatatgggcgaagtcgacatcgccaaggaggccccgaacgtg
gcgcgcatgaaggtgctgggggcgcgtgttatccccgttagcttcggcctgaaaacgctc
aaagaggccgtggatgccgccttcatggcgtattccgaggaatatcacgacgccatctat
tgcatcggcacggctgctggtccgcatccgttcccggtcatggtcagagatttccaagag
gttgtcggcgtggaggcacgtgcccaattcttggagcagaccggtcacctgccggacaaa
atcatggcttgcgtagggggcggctccaacgcgattggtttgtttgtgcctttcctggct
gacccggtcgagatttatggggtcgagccacaaggacggggcacagctttgggcgatcac
gcggccacccttacctacggcggtgaaggtgtgatgcacggcttcaactcgattatgctc
tcggacgaaaagggcaatcccgccccggtctattccaatgcgtccggtctggactacccc
tcggtcggtcctgagcattccctgctgcacgacatggaacgcgtcaattacgtaaccatt
cgcgatgaagaagcaattgaagccctgttcttgctctcgcgcttagaaggcatcatcccc
gccatcgaaagctctcacgctttggcttacgccatcaaggaagcccgcaaaggcaagccc
ggatccatcctggtcaacctgtcgggtcgcggtgataaggacttggatttcgttattgaa
cactacggaacaggcgaagactacgtcaaatag

DBGET integrated database retrieval system