KEGG   Mobiluncus curtisii: HMPREF0573_10003Help
Entry
HMPREF0573_10003  CDS       T01257                                 

Gene name
trpB1
Definition
tryptophan synthase (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0573_10003 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0573_10003 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0573_10003 (trpB1)
Enzymes [BR:mcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0573_10003 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8089..9321
Genome map
AA seq 410 aa AA seqDB search
MNKYRDFDNYLKEYPDEKGYFGKYGGNYLQDPELVKAFDQYAEAYQTIAQSAQFIAELRR
IRKDFQGRPTPVYHCQRLSQKLGRTQIYLKREDLNHTGAHKLNHCMGEGLLAKYMGKKKL
IAETGAGQHGVALATAAAYFGLECDIYMGEVDIAKEAPNVARMKVLGARVIPVSFGLKTL
KEAVDAAFMAYSEEYHDAIYCIGTAAGPHPFPVMVRDFQEVVGVEARAQFLEQTGHLPDK
IMACVGGGSNAIGLFVPFLADPVEIYGVEPQGRGTALGDHAATLTYGGEGVMHGFNSIML
SDEKGNPAPVYSNASGLDYPSVGPEHSLLHDMERVNYVTIRDEEAIEALFLLSRLEGIIP
AIESSHALAYAIKEARKGKPGSILVNLSGRGDKDLDFVIEHYGTGEDYVK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatatcgcgattttgacaactatctcaaagaataccccgacgaaaagggatac
ttcggcaaatacggtggcaactacctgcaggaccccgagctggtcaaagcctttgaccag
tacgccgaggcctaccagacaattgcacagtctgctcagtttattgccgaactgcgccgc
atccgcaaggacttccaaggtcgccccactccggtgtaccactgccagcgtctgagccag
aaactgggtcgcacccagatttatttgaagcgcgaggacttgaaccataccggagcgcac
aagctcaatcactgcatgggtgaaggtctgttggcgaaatacatgggtaaaaagaagctc
atcgcggaaactggagcaggtcagcacggtgtagctctcgccaccgccgccgcctatttc
ggcctggagtgcgacatctatatgggcgaagtcgacatcgccaaggaggccccgaacgtg
gcgcgcatgaaggtgctgggggcgcgtgttatccccgttagcttcggcctgaaaacgctc
aaagaggccgtggatgccgccttcatggcgtattccgaggaatatcacgacgccatctat
tgcatcggcacggctgctggtccgcatccgttcccggtcatggtcagagatttccaagag
gttgtcggcgtggaggcacgtgcccaattcttggagcagaccggtcacctgccggacaaa
atcatggcttgcgtagggggcggctccaacgcgattggtttgtttgtgcctttcctggct
gacccggtcgagatttatggggtcgagccacaaggacggggcacagctttgggcgatcac
gcggccacccttacctacggcggtgaaggtgtgatgcacggcttcaactcgattatgctc
tcggacgaaaagggcaatcccgccccggtctattccaatgcgtccggtctggactacccc
tcggtcggtcctgagcattccctgctgcacgacatggaacgcgtcaattacgtaaccatt
cgcgatgaagaagcaattgaagccctgttcttgctctcgcgcttagaaggcatcatcccc
gccatcgaaagctctcacgctttggcttacgccatcaaggaagcccgcaaaggcaagccc
ggatccatcctggtcaacctgtcgggtcgcggtgataaggacttggatttcgttattgaa
cactacggaacaggcgaagactacgtcaaatag

DBGET integrated database retrieval system