KEGG   Mobiluncus curtisii: HMPREF0573_10015Help
Entry
HMPREF0573_10015  CDS       T01257                                 

Definition
putative dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mcu  Mobiluncus curtisii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mcu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mcu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24594..25094
Genome map
AA seq 166 aa AA seqDB search
MIWAEDKAQVLGAGGKMLWHVPADFKHFKDTTMGSPIIMGRASFLSLGQALPGRRNIVLT
GSREFTAPDVEIAHSLEEALELCARTPQVWITGGAKVYREVMELGLADLLVVTQLDMTAM
VPPMSTVAYAPVIDPVRWQLDLTRSDENWRPKSGDAAWRVRYYIPR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatttgggcagaggacaaagcacaggtcctgggtgctggtggcaagatgctgtggcac
gtccccgcagattttaaacacttcaaagacacgactatgggcagtcctatcatcatggga
cgagcctcgtttctctccctgggtcaggctctgcccggtcggcgcaatatcgtgcttacc
gggtcacgtgaattcaccgctcccgacgtcgagatagcgcacagcctcgaggaagcgttg
gagctttgcgcccgcaccccccaagtgtggattaccggaggagccaaagtttatcgtgaa
gtcatggagttgggactggcagatttgctggtagtcacccaattggacatgaccgctatg
gtgccgccaatgagcacggtggcttatgccccggtgattgaccccgttcgttggcaactg
gacctgacccgttcggatgaaaactggcgcccgaaatctggggatgccgcctggcgagtc
cggtattacatacctcgctag

DBGET integrated database retrieval system