KEGG   Mobiluncus curtisii: HMPREF0573_10246Help
Entry
HMPREF0573_10246  CDS       T01257                                 

Gene name
rafA
Definition
putative alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mcu  Mobiluncus curtisii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mcu00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mcu00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mcu00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(299934..301925)
Genome map
AA seq 663 aa AA seqDB search
MVSGTSDIPPLFSLVPQQSEGWIGTPGLIGSRQSGALFSAFIPIDVQTDGQGTNGAPSEV
TVTLHDEEADINLTIAVEVTPSGVIRGQAKVINTGADGYEVQSLLLGLPTPASETYVLDQ
TGHHLRERDIQKHEFTIGSHQREINVARGHTISSIHGTCQPNTSWQDGLVHYVHVAWSGN
TRTIAEKDTQGYQGILAGELLFPGEVVLKRGEEYCSPWIVGTWGHGLDEAAARMHSFVRS
RTAHPATERPVTLNAWEAVYFDQSLPRLLKLVDLAAEAGAERFVLDDGWFSGRRDDTSSL
GDWTVSAEVWPDGLSPLADAVHSKGMQFGLWFEPEMVNPNSQVAREHPDWMLSPRTHRPQ
EARYQQVMDLTNPKAFEHVKGQMLEVLDSTQIEYIKWDFNRDLYEAVSPTTGCPVYHQQT
LATYRLLRDIKEAHPHLEIESCAGGGGRIDLGIMEYAVRIWGSDCTDPIERKQIEAGTCL
LLPPELIGSHVASPVSHQTGRTLNLSLRASNALFSHMGIEWDLTTASASELKELASWVAL
HKELRPMLHSGRVVHLDHPDRGYWVHGVVSVDQTRAVYAVTRLHSSPQRPSPALCLPGLE
ATTTYRVREMLPQGVESEIGNGQGSVPWWGTGLELPGSVLEHSGIRFPDLNPLQTVLLEV
SAR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
gtggtctcggggacttcagatattccgccgctcttttctttagttccgcaacaaagtgag
gggtggattggaactcctggtctgattggatctcggcagtcaggggcactcttttctgct
ttcattccgattgatgtccaaaccgatggtcagggaaccaatggagcgccctcggaagta
acggtaactctccatgacgaagaagccgatattaatttaaccattgcggtagaagtcacc
ccctctggggtcatccgcgggcaagcgaaagtgattaataccggagctgacggctacgag
gttcaatcgctactgctggggctgcccactccggcaagtgaaacctatgtattggaccaa
acggggcaccatctgcgagaacgtgatattcaaaagcatgagttcactattggctcccac
cagcgagaaattaatgttgctcgcggacatactatttccagcattcatggcacctgccag
ccgaatacctcttggcaggacggactcgttcactatgtgcatgtggcgtggtcgggcaat
actcgcactatcgcagaaaaagacacgcagggttatcagggcatattggcgggagaattg
ctgttccctggcgaggtggtactcaaacgtggtgaagagtactgctcaccctggattgtg
ggaacctggggacacggtctcgatgaggcagcagctcggatgcatagttttgttcgcagt
cggactgcccatcctgctaccgaacgccccgttactctcaacgcttgggaagcggtctac
tttgaccagtccttgccgcgtttgctgaaattggtagatttggcagccgaagccggggca
gaacgttttgtactcgatgacggatggttctcgggacgccgtgacgatacctcaagtttg
ggggattggactgtgtccgcagaagtgtggcctgacggtctttctccgctggctgacgcg
gtccacagtaaagggatgcaattcggcttgtggtttgaacccgaaatggtgaatcctaac
tcccaagtggcgcgcgaacatccagattggatgctttctccacgtacccaccgtccgcaa
gaagcgcgctatcagcaggtcatggacctgaccaatcccaaagcctttgagcatgttaag
gggcaaatgctggaagtattggattcaacgcagattgaatatattaagtgggacttcaat
cgtgacctctacgaagcggtttctcccactaccggttgtccggtgtaccatcagcaaaca
ctagcgacctatcgcttactgcgagatattaaagaagcccatccgcatctcgaaattgag
tcttgtgcaggagggggaggacgcatcgatttagggataatggaatatgcggtgcgaatt
tggggatctgactgtacagatccgattgagcgtaagcagatagaagcgggtacctgtttg
ctgcttcccccagagctaattggctcccacgtggcttcccccgtgtcgcaccagaccggt
cgaaccttaaatttgtcgttgcgcgcatctaacgcattgttctctcacatgggaattgaa
tgggacttgacaacggctagtgcgtcagagcttaaagaactcgccagctgggtagcgctt
cacaaggagctgcgcccaatgttgcactccggacgagtcgttcatctagatcaccctgac
cggggatattgggtgcatggggtagtatccgttgatcaaacgcgtgcagtctatgcggtg
acccgtttacatagctctccccaacgcccttcgccggcactatgcctgccgggtctggaa
gccacaactacttatcgagtacgtgaaatgctcccacaaggtgtcgaatcagaaatcggt
aacggacagggttccgtcccttggtggggaacaggcttagagctgccggggagtgtcctt
gaacactctggaattcgtttcccggatttaaatcccctgcaaacagtgttattagaagta
tctgctagataa

DBGET integrated database retrieval system