KEGG   Mobiluncus curtisii: HMPREF0573_10365Help
Entry
HMPREF0573_10365  CDS       T01257                                 

Definition
hypothetical protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
mcu  Mobiluncus curtisii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0573_10365
Enzymes [BR:mcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HMPREF0573_10365
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     HMPREF0573_10365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(412123..413421)
Genome map
AA seq 432 aa AA seqDB search
MTLHNASNSDFPQEIRGRQVDVLDSLDGLDSITLRGIFARGIHGVLESEHHAPQDFSVDL
TLWFDSRRAASSDDVADTVDYSVVAEKIVAVIEGKSAALIERLATHIALSVLEDSRIAAV
QVTLHKPHACLNVQFEDVAIRILRTRSDFEAHQADFPVNLTQRPDQIRPAVLALGANLGN
PLATLREVVAALQSAPEFERVEVSPLARTRPVLQPGAAPQPDYYNAVVRVWSRLSAVELL
KLAHHLEDSHGRERPYHWAARTLDVDVIDVEGVVSADSRLVLPHPRAATRAFVLVPWSQL
DPQATLEGRTVAKLAAWAQDVDGIVNLWADWLETNLDTESAKPASNLSAAGSSGTPEVSP
RSDSPVRDRDSFGLPSWQAALPQTEARPRVVDNDTEIDIIRQQSVAPAASSLSSASPAVP
VPEWKRVRRRRH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcataatgcttccaattcggattttccccaggaaatccgtggacgtcaggtt
gacgtgcttgactcattagacgggctcgattccattaccttgcgcggaattttcgcgcgg
ggtatccatggagttttggaatctgagcatcacgctccgcaggatttttcagtcgacctc
accttgtggtttgattcccgtagggctgccagctcggatgacgtcgccgacaccgttgac
tactcggtcgtggcagaaaagattgtcgcggtcattgaggggaaaagtgccgctctgatt
gaacgtctggctacgcacatcgccttgtctgtattggaggactcgcgcattgcagcagtc
caagtcaccttgcataagccacacgcgtgtctcaacgtgcaatttgaagatgtggcgata
cgtattttgcggactcggtcagattttgaagcacaccaggctgattttccggtcaatctg
acccagcgtccggatcagattcgccccgcagttttagctttgggtgcgaacttgggcaat
ccgctggcaaccctgcgagaggtcgtggcagccttgcagtctgccccagagtttgagcgc
gtggaagtctcacccctggcacggactcgtccggtgttgcaacccggtgctgccccgcaa
ccggattattacaacgcagtggtgcgagtatggtcgcggttgtctgccgtagagctgtta
aagctagcgcatcatcttgaggatagccacgggagagaacgcccttatcattgggcagca
cgcactttggatgttgacgtgattgacgtggaaggggtcgtttcggcagattctcgtttg
gtcttgccccacccgcgagccgccacgcgggcgtttgtcctggtgccttggtcgcagctg
gacccgcaggcaactttggaaggtcgcactgtcgccaaactcgcagcgtgggcacaagac
gtcgacggtatcgtgaacttgtgggcagactggctggaaaccaatctagatacggaatcg
gcaaaaccggcgtcaaacctttctgctgctggttcttcgggtactcccgaagtttctccg
cggagcgattctccggtcagggaccgtgacagtttcggtctgccgtcttggcaagccgcc
ttgccccagactgaagcccggcctcgcgtggtcgacaatgacactgaaatcgacattatc
cgtcaacaatcagtcgctcctgccgcgagttctctttcctccgcatcgcccgcggttccg
gtaccggagtggaaacgggtcaggagacggcggcactga

DBGET integrated database retrieval system