KEGG   Mobiluncus curtisii: HMPREF0573_10366Help
Entry
HMPREF0573_10366  CDS       T01257                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mcu  Mobiluncus curtisii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0573_10366
Enzymes [BR:mcu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HMPREF0573_10366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413437..414246)
Genome map
AA seq 269 aa AA seqDB search
MGILNVTPNSFSDGGKWFDSSQAVAHGLEMVAQGADLIDVGGESTAPGRKPVEVEEEIAR
VLPVISKLSEAGVTVSVDTLHAETAQAAAAAGASIINDVSGGIVDDTMFATIATLQSRYP
QLSYICQHWRGSPEVANQLAVYDNVAAETWREVESRLELMRHSDIDMRRVIIDPGLGFSK
VGEQDWEVLANLEVFLHRGYPVLLGPSRKRYLADLETVASDRHARDDATAAVSMFCALHK
VWAVRVHNVAPVAVAVQAAARLDAHRHSC
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggggattttgaacgtaaccccgaattccttttctgatgggggaaaatggtttgattca
agccaggcagtagcgcatggtttggaaatggtggcacagggagctgacctgattgatgtg
gggggtgaatccaccgcgcccggtcgcaaaccggtggaggttgaagaagaaatcgcccgt
gtcctgccggtgatttcgaaactgtcagaagcgggggtgactgtttccgtggatactctg
catgcggaaactgcccaggcggccgcggcggcgggagccagcatcattaacgatgtttcg
ggtggcatcgtggatgacaccatgtttgccaccattgccacgttgcagtcacgttacccg
cagctgagctacatttgccagcattggcggggcagtcctgaggtagctaaccagttggca
gtttatgacaatgttgctgcggaaacctggcgcgaggtggagtcgcgcctggagctaatg
cgccacagcgatattgatatgcggcgagtcatcattgatcccggtctggggttttccaaa
gttggcgaacaggattgggaagtcctggctaacctcgaggtgtttttacatcggggctac
ccggtgcttctcggaccatcgcggaaacgatatttggctgacttggaaacagtcgcgagt
gaccggcatgcccgtgacgatgccaccgcggcagtttctatgttttgtgcgctgcacaag
gtttgggcagtgcgggtacacaacgttgccccggtggcagtagctgtccaggcggcagct
cgcctggacgcccaccgccattcttgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system