KEGG   Mobiluncus curtisii: HMPREF0573_10379Help
Entry
HMPREF0573_10379  CDS       T01257                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0573_10379 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0573_10379 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0573_10379 (thrC)
Enzymes [BR:mcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0573_10379 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(429708..430919)
Genome map
AA seq 403 aa AA seqDB search
MPKPAPSRAKTVEVIETTIKEQPNMAQMWSGLLEEYRNRLPLEPSDPVVTLFEGNTPLIR
ARRVEQRIGALSDKAGVDTTGTEVYVKFEGANPTGSFKDRGMTMAMTKVKAAGTQMVACA
STGNTSASAAAYSVAAGVGCAVILPAGKIALGKLAQAVMHGAKLIAVDGNFDDCLRITRE
LTEKYPVDLVNSINPYRLQGQKTAAFEICDAFGDAPDIHCLPVGNAGNISAYWMGYNEYF
GRKVASSIEDSAQKLKPQTTKLPQMWGIQANGAAPFVAGHPIENPETIATAIRIGNPASW
DYATAARDDSGGLITAVSDAAIMQAQSIIAAEVGVFCEPASAAPVAGLLALAEQGKVPGG
VRIVCTLTGNGLKDTATAMEAKGNMTPPVIAPSLQAAVRELGL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaagccggcaccgtcgagggcaaaaactgttgaagttatcgaaaccacgattaag
gagcaaccaaacatggcacagatgtggagcggtctgctggaagaataccggaatcgactt
cccctggaacccagcgaccccgtcgtgactctgtttgagggcaatactcccttgattcgg
gcgcgccgggtggaacagcgcatcggtgccctgagcgataaagctggtgtagacaccact
ggtaccgaagtttatgtgaaatttgagggcgccaatcccaccggttcattcaaagaccgg
ggcatgaccatggccatgacaaaggtgaaagcagctggtacgcagatggtcgcttgcgct
tccaccggcaacacctccgcatcggcggcggcttactcggtcgcggcaggagtgggatgc
gcagtcattttgcctgctggaaagattgccctgggtaagctggcgcaggcggtgatgcac
ggagccaagctgattgccgtggatggaaactttgacgactgcttgcgaatcaccagggag
ctgacggaaaagtacccggtggatttggtcaattcgataaatccttaccgtttgcaagga
caaaaaactgccgcttttgaaatctgcgatgcctttggtgatgccccggatattcactgc
ctgccagtgggcaacgccggaaatatcagcgcctattggatgggatataacgagtatttc
ggacggaaagtggcatcctcaatcgaggattccgcccagaaactgaaaccgcaaaccacc
aagctgccgcaaatgtgggggattcaagccaacggagccgcgcctttcgtggcgggacac
cccattgagaatccggaaactatcgccaccgcgatacgaattggcaacccagcgtcttgg
gactacgccaccgcagcacgcgacgactccggaggcttgattaccgccgtcagcgatgcc
gccatcatgcaagcgcagtccattattgccgcggaagtcggcgtgttttgtgagcctgcc
agcgctgccccggtagcgggtctgttggcattagctgagcagggcaaagtgcctggtggg
gttcgcattgtttgcactcttaccggcaacggcttgaaagatactgccaccgcgatggaa
gctaaaggtaacatgactccgcccgtaattgcacctagcctgcaggcggcagtgcgggaa
ctcggtctgtaa

DBGET integrated database retrieval system