KEGG   Mobiluncus curtisii: HMPREF0573_10379Help
Entry
HMPREF0573_10379  CDS       T01257                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mcu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mcu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(429708..430919)
Genome map
AA seq 403 aa AA seqDB search
MPKPAPSRAKTVEVIETTIKEQPNMAQMWSGLLEEYRNRLPLEPSDPVVTLFEGNTPLIR
ARRVEQRIGALSDKAGVDTTGTEVYVKFEGANPTGSFKDRGMTMAMTKVKAAGTQMVACA
STGNTSASAAAYSVAAGVGCAVILPAGKIALGKLAQAVMHGAKLIAVDGNFDDCLRITRE
LTEKYPVDLVNSINPYRLQGQKTAAFEICDAFGDAPDIHCLPVGNAGNISAYWMGYNEYF
GRKVASSIEDSAQKLKPQTTKLPQMWGIQANGAAPFVAGHPIENPETIATAIRIGNPASW
DYATAARDDSGGLITAVSDAAIMQAQSIIAAEVGVFCEPASAAPVAGLLALAEQGKVPGG
VRIVCTLTGNGLKDTATAMEAKGNMTPPVIAPSLQAAVRELGL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaagccggcaccgtcgagggcaaaaactgttgaagttatcgaaaccacgattaag
gagcaaccaaacatggcacagatgtggagcggtctgctggaagaataccggaatcgactt
cccctggaacccagcgaccccgtcgtgactctgtttgagggcaatactcccttgattcgg
gcgcgccgggtggaacagcgcatcggtgccctgagcgataaagctggtgtagacaccact
ggtaccgaagtttatgtgaaatttgagggcgccaatcccaccggttcattcaaagaccgg
ggcatgaccatggccatgacaaaggtgaaagcagctggtacgcagatggtcgcttgcgct
tccaccggcaacacctccgcatcggcggcggcttactcggtcgcggcaggagtgggatgc
gcagtcattttgcctgctggaaagattgccctgggtaagctggcgcaggcggtgatgcac
ggagccaagctgattgccgtggatggaaactttgacgactgcttgcgaatcaccagggag
ctgacggaaaagtacccggtggatttggtcaattcgataaatccttaccgtttgcaagga
caaaaaactgccgcttttgaaatctgcgatgcctttggtgatgccccggatattcactgc
ctgccagtgggcaacgccggaaatatcagcgcctattggatgggatataacgagtatttc
ggacggaaagtggcatcctcaatcgaggattccgcccagaaactgaaaccgcaaaccacc
aagctgccgcaaatgtgggggattcaagccaacggagccgcgcctttcgtggcgggacac
cccattgagaatccggaaactatcgccaccgcgatacgaattggcaacccagcgtcttgg
gactacgccaccgcagcacgcgacgactccggaggcttgattaccgccgtcagcgatgcc
gccatcatgcaagcgcagtccattattgccgcggaagtcggcgtgttttgtgagcctgcc
agcgctgccccggtagcgggtctgttggcattagctgagcagggcaaagtgcctggtggg
gttcgcattgtttgcactcttaccggcaacggcttgaaagatactgccaccgcgatggaa
gctaaaggtaacatgactccgcccgtaattgcacctagcctgcaggcggcagtgcgggaa
ctcggtctgtaa

DBGET integrated database retrieval system