KEGG   Mobiluncus curtisii: HMPREF0573_10449Help
Entry
HMPREF0573_10449  CDS       T01257                                 

Gene name
pncA
Definition
putative nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mcu  Mobiluncus curtisii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mcu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(514764..515360)
Genome map
AA seq 198 aa AA seqDB search
MAEMKRALLIVDVQPTFCEGGALGVVGGNEVAERIADFVTEHEDEYEIIVTTQDWHINPG
AHFSDHPDFIDTWPPHGIAGTAEAELHDAIASLPFDDSVKKGQYAAAYSGFEGVNKSGDT
LEEILRRADITDVDVVGIAESHCVKDTALDALDLGWPTRVFEDLTVPVSAELGEAAREEM
AQAGIDEIPSTDAFKAVD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatgaaacgtgcattgttgattgtcgatgtccaaccgaccttttgtgaaggc
ggagccctaggggtggttgggggcaacgaggttgccgagcggattgcggactttgtcact
gagcatgaggacgaatacgagattattgtcaccactcaggattggcatattaacccggga
gcgcatttctccgaccatccagactttatagacacctggcctcctcacgggatagcgggc
accgcagaagcggaactgcacgacgctattgcctccctcccttttgatgattccgttaag
aagggtcagtatgcggcggcttattccggctttgaaggggtgaacaagtcgggggatact
ttggaagagattttgcgtcgcgccgacattaccgatgtagatgtggtcggtatcgcggaa
tcgcactgtgtgaaagacaccgctttggatgccctggatttgggttggccgacccgcgtc
tttgaggacctcaccgttccagtttcagcagagctaggggaagcagcccgtgaagagatg
gcacaggctgggatagacgaaattcccagcaccgacgcttttaaggcagttgactga

DBGET integrated database retrieval system