KEGG   Mobiluncus curtisii: HMPREF0573_10482Help
Entry
HMPREF0573_10482  CDS       T01257                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mcu  Mobiluncus curtisii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0573_10482
   00052 Galactose metabolism
    HMPREF0573_10482
   00500 Starch and sucrose metabolism
    HMPREF0573_10482
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0573_10482
Enzymes [BR:mcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0573_10482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(557883..558815)
Genome map
AA seq 310 aa AA seqDB search
MSLEVRCSVIPAAGKGTRMYPLTKSVPKELFPLVDRPVIMTVIDEALQCGIEQFHVVTSP
RKATLGDFFTDTGDESDSQDLPLPQVDLVMQEQAKGLGHAVLQARDSVGEQPFVVQLPDD
LYHPEDPLLQTMLDVHAITGGCVVALMKVSVAEAKLYSSARVESVDLGAAAAGHEVFKLA
DIIEKPDANQVRSPYALMGRYVLSPRIFEILERTAPGRNNEIQLTDALATFAEIPAHEGG
GVWGVVSQGRHFDTGNLTGYLQAQMELSLENPDFGAELRKFMRGLVGTDESTVVKTPPGK
CRESGQKGRR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagaagttaggtgctccgtcatccctgctgccgggaagggaacccggatgtat
cctctgaccaaatcggtccccaaagagctgtttcccctagtggatcgaccggtaattatg
accgtgattgatgaggctctccagtgtgggattgagcagtttcacgtggtgaccagtcca
cgaaaggcaactctgggagatttttttaccgataccggcgacgagtctgattcgcaggat
ttgcccttgccccaggttgatttggtgatgcaggaacaggctaaggggcttggtcatgcc
gttctgcaggctcgtgattctgtcggggaacagccttttgtggtgcagcttccggatgat
ttgtaccacccggaagatcccttgctgcaaacgatgctggatgtgcacgcgataaccgga
gggtgtgtggtagccctgatgaaggttagcgtggcggaagcgaaactttacagctccgca
cgggtcgagtcggttgacttgggagcggcagcagcgggacacgaagtgttcaaattggct
gacattattgagaaaccggatgcgaatcaggttcgttcgccttacgccttgatgggacgt
tacgtgttgagtcctcgcatttttgaaattttggaacgtactgctccggggcgcaataac
gagattcagcttactgatgcgctcgcgacttttgctgaaattcctgctcatgagggaggc
ggagtgtggggagttgtctcccagggacgccacttcgacaccggcaatttgacgggatac
ttgcaggcgcaaatggagctttccctggagaaccccgatttcggtgctgagcttcggaaa
tttatgcggggcttagtcggcactgatgaatcaacagtggtcaaaactcctccggggaaa
tgtcgcgaatcaggtcagaaaggcaggcgctga

DBGET integrated database retrieval system