KEGG   Mobiluncus curtisii: HMPREF0573_10585Help
Entry
HMPREF0573_10585  CDS       T01257                                 

Definition
putative ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mcu  Mobiluncus curtisii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0573_10585
Enzymes [BR:mcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0573_10585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(684943..685887)
Genome map
AA seq 314 aa AA seqDB search
MSSDELGDSLETQFENGGAICFIGEPVLDIYINLDHWPKLGDKACLLSQETLPGGTVANM
AVNASWLGLKTRMIGCLKSGEISDQLIKDLNEHGVNTDFISLTTDAPDPVCYVFLTEGSN
VAAYPDRSREKLFLDQESLETISKSRVVCSTPEKLRRICNHDDFLQSIRKVKRSGGHLVL
DIDTGAEFDAKHPLETEASIVIMNEFGAERLFGMNWEQLSSRLPDQSPDIKSVFTCPDIT
LFVTGSEKGVWTYRDGWRLWEVTPAPVVDPTGAGDAFVAGIVTGIAQGYSFERCVLQALD
CGKQAVGIKGARLR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgacgagctaggagattcacttgaaacacagttcgagaacgggggtgctatc
tgtttcatcggtgaacccgttcttgacatatatataaatcttgaccattggccgaagctg
ggggataaggcatgtctgctgagtcaagagaccttgcctggaggaacagtagctaatatg
gcagtcaatgcctcttggttagggctaaagacccgcatgatcggctgtctaaaatccgga
gaaatcagcgaccagctgataaaagacttaaatgagcatggggttaacaccgacttcatt
tccttgactaccgacgcgcctgaccctgtctgttacgtctttttaactgaaggaagtaat
gtggcagcgtacccggatcgttcaagggaaaagctgtttttagatcaggagagcctagaa
acgatttcaaaatcaagagtggtgtgctcgacacctgaaaaactgagaagaatatgtaat
catgatgattttctgcaatcgattcgtaaggtgaagcgttcaggggggcatctggtgctt
gatatagataccggcgcagaattcgatgctaaacaccctctagaaacagaggcttccata
gtaattatgaatgagtttggggctgagcgtctatttggcatgaactgggaacagctatct
tcacgactaccagaccaatctcccgacattaaatccgtatttacatgcccggatattact
ctgttcgtaaccgggtcagaaaagggcgtgtggacttacagagatggatggcgcctgtgg
gaggtaactcccgctccggtagtagatccgaccggggcaggagatgctttcgttgccgga
atcgttactggtatagcacaaggttattcctttgaacgttgcgttttgcaggcgttagac
tgtggtaagcaggcggtgggaataaagggtgcccgattacgctga

DBGET integrated database retrieval system