KEGG   Mobiluncus curtisii: HMPREF0573_10718Help
Entry
HMPREF0573_10718  CDS       T01257                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0573_10718
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0573_10718
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_10718
   00620 Pyruvate metabolism
    HMPREF0573_10718
   00640 Propanoate metabolism
    HMPREF0573_10718
   00650 Butanoate metabolism
    HMPREF0573_10718
  Energy metabolism
   00680 Methane metabolism
    HMPREF0573_10718
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0573_10718
Enzymes [BR:mcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0573_10718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
839707..840273
Genome map
AA seq 188 aa AA seqDB search
MVEIRVHGRGGQGVVTASDLMAYAAFADGHHAQAFPSFGSERTGAPVVSYCRIEDKAIRS
REPILDPDIVIVQDPTLLAIMDPFSGLKDNGYALVNSQKTAAELGVSELETRLPQGHFMS
MPASEIALEKLGRPLPNAVLLGGLAALTGIIKLESVEDAIRGKFKGKVGDSNVEAAATAY
EYVKANMV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggttgagattcgagtacacggtcgcggtggtcagggtgtggttaccgcttccgattta
atggcttacgcggcttttgctgacggccaccacgcccaagccttcccgtctttcgggtcg
gaacggaccggcgctcccgtcgtgagctattgccggattgaagataaggcaattcgctct
cgggaacctatcttggatccggacattgtcatcgtacaagacccgaccttgctggcaatt
atggatccgttttcgggactgaaagataacggatacgcgctggtaaattcccaaaagacc
gctgccgaactgggggtgtcagagctcgagaccaggctgccgcagggtcattttatgtcc
atgcccgcctctgaaatcgccctggaaaagctgggacgtcccctgccgaacgcagttttg
ctgggcggactggcagcgctgaccgggatcatcaaactggaatcggtcgaggacgccatt
cgtggcaagtttaaaggcaaagtcggtgactccaacgtagaagccgccgcgaccgcttat
gaatatgtaaaagcaaacatggtctga

DBGET integrated database retrieval system