KEGG   Mobiluncus curtisii: HMPREF0573_10719Help
Entry
HMPREF0573_10719  CDS       T01257                                 

Gene name
porA
Definition
pyruvate synthase (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0573_10719 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0573_10719 (porA)
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_10719 (porA)
   00620 Pyruvate metabolism
    HMPREF0573_10719 (porA)
   00640 Propanoate metabolism
    HMPREF0573_10719 (porA)
   00650 Butanoate metabolism
    HMPREF0573_10719 (porA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0573_10719 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0573_10719 (porA)
Enzymes [BR:mcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0573_10719 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840340..841698
Genome map
AA seq 452 aa AA seqDB search
MLKQIEGSQAIARAVAACQPNVVAAYPISPQTHIVEALSALVKSGQLEHCEYVNVESEFA
AMSACIGSSAVGARSYTATASQGLLYMVEAVYNAAGLGFPIVMTVANRAIGAPINIWNDH
SDSMSQRDSGWLQLFAENNQEAADLHVQAFRIAEELSVPVMVCMDGFILTHAVEQVDLPE
SEQVKQFLPPYEPRQVLDPDDPLSIGAMVGPEAFTEVRYIAHHKMLQALDLIPQVQSEFK
SIFGRDSGGLLHTYRCEDAETIIVALGSVVGTLKDVVDQRRENGEKIGIMSLVSFRPFPF
AAIREVLQSAKRVVCLEKAFQLGIGGIVSSELRAAMRGLPFTCYEVIAGLGGRNITKNSL
HAMLDQAVADTIEPLTFMDLDMELVQGELEREAATRRSGAFATNLQRERVLRANAKIAEA
GPKPKADKVGNPRVASPSIKQDAVPVVPDQAE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacaaatcgaaggctcccaggcgattgctcgagccgtcgcggcttgccagccc
aacgtggtcgctgcctaccccatcagtccccaaacccacatcgtcgaagccctgtccgcc
ctggtgaagtccggtcaactcgaacattgtgaatacgtcaacgtcgagagcgagtttgct
gccatgagtgcctgtatcgggtcttcagccgtgggggcacgttcctataccgctaccgct
tcacaaggtctgctctatatggtcgaggccgtgtataacgctgccggtctgggctttccc
atcgtaatgaccgtggcgaaccgagccatcggtgcgcctatcaatatctggaatgaccac
agcgactcgatgagccagcgtgattccggatggctgcaactgtttgctgaaaacaaccaa
gaggccgcggacctgcacgtgcaggcgtttcgcatcgcggaggaactcagcgtaccggtg
atggtgtgcatggacgggtttatcctcacccacgcggtcgaacaggtcgacctgcccgaa
tcggaacaggtcaaacagttcctgcccccttatgaaccccgtcaagtactggacccggac
gatccgctctctatcggggcaatggtcggtcccgaagcctttaccgaagtgcgctatatc
gcccaccacaagatgctgcaggccttggacctcattccgcaggtacagtctgagtttaag
agtatttttgggcgagattccggcggtttgctgcacacctaccgttgcgaggacgccgaa
accatcattgtggcgctgggctccgtggtcggcacgctcaaggacgtggttgatcagcgg
cgtgagaatggcgaaaagattggcattatgtctctcgtgtccttccggcccttccccttc
gcggccatccgtgaggtgttgcaaagcgcgaagcgcgtggtgtgtctcgaaaaagccttc
cagctggggattggcgggattgtttcttccgagctgcgcgcggcgatgcgcggactgcct
ttcacctgctacgaagttattgctgggttgggtgggcgcaacatcaccaagaattccctg
cacgccatgctggatcaggccgtggcagacaccatcgagcctctgaccttcatggacttg
gacatggaactggtgcaaggagaactggagcgagaagccgctacccggcgctccggcgct
tttgccaccaacctgcaacgcgaacgggtgctgcgcgccaacgcaaaaattgccgaagcc
ggtccgaaacccaaggcggacaaggtcggcaacccgcgcgtggcttccccgtccatcaag
caagacgccgtcccggtagtgcccgaccaggccgaataa

DBGET integrated database retrieval system