KEGG   Mobiluncus curtisii: HMPREF0573_10719Help
Entry
HMPREF0573_10719  CDS       T01257                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0573_10719
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0573_10719
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_10719
   00620 Pyruvate metabolism
    HMPREF0573_10719
   00640 Propanoate metabolism
    HMPREF0573_10719
   00650 Butanoate metabolism
    HMPREF0573_10719
  Energy metabolism
   00680 Methane metabolism
    HMPREF0573_10719
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0573_10719
Enzymes [BR:mcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0573_10719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
840340..841698
Genome map
AA seq 452 aa AA seqDB search
MLKQIEGSQAIARAVAACQPNVVAAYPISPQTHIVEALSALVKSGQLEHCEYVNVESEFA
AMSACIGSSAVGARSYTATASQGLLYMVEAVYNAAGLGFPIVMTVANRAIGAPINIWNDH
SDSMSQRDSGWLQLFAENNQEAADLHVQAFRIAEELSVPVMVCMDGFILTHAVEQVDLPE
SEQVKQFLPPYEPRQVLDPDDPLSIGAMVGPEAFTEVRYIAHHKMLQALDLIPQVQSEFK
SIFGRDSGGLLHTYRCEDAETIIVALGSVVGTLKDVVDQRRENGEKIGIMSLVSFRPFPF
AAIREVLQSAKRVVCLEKAFQLGIGGIVSSELRAAMRGLPFTCYEVIAGLGGRNITKNSL
HAMLDQAVADTIEPLTFMDLDMELVQGELEREAATRRSGAFATNLQRERVLRANAKIAEA
GPKPKADKVGNPRVASPSIKQDAVPVVPDQAE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacaaatcgaaggctcccaggcgattgctcgagccgtcgcggcttgccagccc
aacgtggtcgctgcctaccccatcagtccccaaacccacatcgtcgaagccctgtccgcc
ctggtgaagtccggtcaactcgaacattgtgaatacgtcaacgtcgagagcgagtttgct
gccatgagtgcctgtatcgggtcttcagccgtgggggcacgttcctataccgctaccgct
tcacaaggtctgctctatatggtcgaggccgtgtataacgctgccggtctgggctttccc
atcgtaatgaccgtggcgaaccgagccatcggtgcgcctatcaatatctggaatgaccac
agcgactcgatgagccagcgtgattccggatggctgcaactgtttgctgaaaacaaccaa
gaggccgcggacctgcacgtgcaggcgtttcgcatcgcggaggaactcagcgtaccggtg
atggtgtgcatggacgggtttatcctcacccacgcggtcgaacaggtcgacctgcccgaa
tcggaacaggtcaaacagttcctgcccccttatgaaccccgtcaagtactggacccggac
gatccgctctctatcggggcaatggtcggtcccgaagcctttaccgaagtgcgctatatc
gcccaccacaagatgctgcaggccttggacctcattccgcaggtacagtctgagtttaag
agtatttttgggcgagattccggcggtttgctgcacacctaccgttgcgaggacgccgaa
accatcattgtggcgctgggctccgtggtcggcacgctcaaggacgtggttgatcagcgg
cgtgagaatggcgaaaagattggcattatgtctctcgtgtccttccggcccttccccttc
gcggccatccgtgaggtgttgcaaagcgcgaagcgcgtggtgtgtctcgaaaaagccttc
cagctggggattggcgggattgtttcttccgagctgcgcgcggcgatgcgcggactgcct
ttcacctgctacgaagttattgctgggttgggtgggcgcaacatcaccaagaattccctg
cacgccatgctggatcaggccgtggcagacaccatcgagcctctgaccttcatggacttg
gacatggaactggtgcaaggagaactggagcgagaagccgctacccggcgctccggcgct
tttgccaccaacctgcaacgcgaacgggtgctgcgcgccaacgcaaaaattgccgaagcc
ggtccgaaacccaaggcggacaaggtcggcaacccgcgcgtggcttccccgtccatcaag
caagacgccgtcccggtagtgcccgaccaggccgaataa

DBGET integrated database retrieval system