KEGG   Mobiluncus curtisii: HMPREF0573_10719Help
Entry
HMPREF0573_10719  CDS       T01257                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-binding domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00010  Glycolysis / Gluconeogenesis
mcu00020  Citrate cycle (TCA cycle)
mcu00620  Pyruvate metabolism
mcu00633  Nitrotoluene degradation
mcu00640  Propanoate metabolism
mcu00650  Butanoate metabolism
mcu00680  Methane metabolism
mcu01100  Metabolic pathways
mcu01120  Microbial metabolism in diverse environments
mcu01130  Biosynthesis of antibiotics
mcu01200  Carbon metabolism
Module
mcu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0573_10719
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_10719
   00620 Pyruvate metabolism
    HMPREF0573_10719
   00640 Propanoate metabolism
    HMPREF0573_10719
   00650 Butanoate metabolism
    HMPREF0573_10719
  Energy metabolism
   00680 Methane metabolism
    HMPREF0573_10719
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0573_10719
Enzymes [BR:mcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0573_10719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADI67038
UniProt: D6ZJY9
Position
840340..841698
Genome map
AA seq 452 aa AA seqDB search
MLKQIEGSQAIARAVAACQPNVVAAYPISPQTHIVEALSALVKSGQLEHCEYVNVESEFA
AMSACIGSSAVGARSYTATASQGLLYMVEAVYNAAGLGFPIVMTVANRAIGAPINIWNDH
SDSMSQRDSGWLQLFAENNQEAADLHVQAFRIAEELSVPVMVCMDGFILTHAVEQVDLPE
SEQVKQFLPPYEPRQVLDPDDPLSIGAMVGPEAFTEVRYIAHHKMLQALDLIPQVQSEFK
SIFGRDSGGLLHTYRCEDAETIIVALGSVVGTLKDVVDQRRENGEKIGIMSLVSFRPFPF
AAIREVLQSAKRVVCLEKAFQLGIGGIVSSELRAAMRGLPFTCYEVIAGLGGRNITKNSL
HAMLDQAVADTIEPLTFMDLDMELVQGELEREAATRRSGAFATNLQRERVLRANAKIAEA
GPKPKADKVGNPRVASPSIKQDAVPVVPDQAE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacaaatcgaaggctcccaggcgattgctcgagccgtcgcggcttgccagccc
aacgtggtcgctgcctaccccatcagtccccaaacccacatcgtcgaagccctgtccgcc
ctggtgaagtccggtcaactcgaacattgtgaatacgtcaacgtcgagagcgagtttgct
gccatgagtgcctgtatcgggtcttcagccgtgggggcacgttcctataccgctaccgct
tcacaaggtctgctctatatggtcgaggccgtgtataacgctgccggtctgggctttccc
atcgtaatgaccgtggcgaaccgagccatcggtgcgcctatcaatatctggaatgaccac
agcgactcgatgagccagcgtgattccggatggctgcaactgtttgctgaaaacaaccaa
gaggccgcggacctgcacgtgcaggcgtttcgcatcgcggaggaactcagcgtaccggtg
atggtgtgcatggacgggtttatcctcacccacgcggtcgaacaggtcgacctgcccgaa
tcggaacaggtcaaacagttcctgcccccttatgaaccccgtcaagtactggacccggac
gatccgctctctatcggggcaatggtcggtcccgaagcctttaccgaagtgcgctatatc
gcccaccacaagatgctgcaggccttggacctcattccgcaggtacagtctgagtttaag
agtatttttgggcgagattccggcggtttgctgcacacctaccgttgcgaggacgccgaa
accatcattgtggcgctgggctccgtggtcggcacgctcaaggacgtggttgatcagcgg
cgtgagaatggcgaaaagattggcattatgtctctcgtgtccttccggcccttccccttc
gcggccatccgtgaggtgttgcaaagcgcgaagcgcgtggtgtgtctcgaaaaagccttc
cagctggggattggcgggattgtttcttccgagctgcgcgcggcgatgcgcggactgcct
ttcacctgctacgaagttattgctgggttgggtgggcgcaacatcaccaagaattccctg
cacgccatgctggatcaggccgtggcagacaccatcgagcctctgaccttcatggacttg
gacatggaactggtgcaaggagaactggagcgagaagccgctacccggcgctccggcgct
tttgccaccaacctgcaacgcgaacgggtgctgcgcgccaacgcaaaaattgccgaagcc
ggtccgaaacccaaggcggacaaggtcggcaacccgcgcgtggcttccccgtccatcaag
caagacgccgtcccggtagtgcccgaccaggccgaataa

DBGET integrated database retrieval system