KEGG   Mobiluncus curtisii: HMPREF0573_10719Help
Entry
HMPREF0573_10719  CDS       T01257                                 

Gene name
porA
Definition
pyruvate synthase (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mcu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mcu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mcu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mcu00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mcu00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mcu00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mcu00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840340..841698
Genome map
AA seq 452 aa AA seqDB search
MLKQIEGSQAIARAVAACQPNVVAAYPISPQTHIVEALSALVKSGQLEHCEYVNVESEFA
AMSACIGSSAVGARSYTATASQGLLYMVEAVYNAAGLGFPIVMTVANRAIGAPINIWNDH
SDSMSQRDSGWLQLFAENNQEAADLHVQAFRIAEELSVPVMVCMDGFILTHAVEQVDLPE
SEQVKQFLPPYEPRQVLDPDDPLSIGAMVGPEAFTEVRYIAHHKMLQALDLIPQVQSEFK
SIFGRDSGGLLHTYRCEDAETIIVALGSVVGTLKDVVDQRRENGEKIGIMSLVSFRPFPF
AAIREVLQSAKRVVCLEKAFQLGIGGIVSSELRAAMRGLPFTCYEVIAGLGGRNITKNSL
HAMLDQAVADTIEPLTFMDLDMELVQGELEREAATRRSGAFATNLQRERVLRANAKIAEA
GPKPKADKVGNPRVASPSIKQDAVPVVPDQAE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacaaatcgaaggctcccaggcgattgctcgagccgtcgcggcttgccagccc
aacgtggtcgctgcctaccccatcagtccccaaacccacatcgtcgaagccctgtccgcc
ctggtgaagtccggtcaactcgaacattgtgaatacgtcaacgtcgagagcgagtttgct
gccatgagtgcctgtatcgggtcttcagccgtgggggcacgttcctataccgctaccgct
tcacaaggtctgctctatatggtcgaggccgtgtataacgctgccggtctgggctttccc
atcgtaatgaccgtggcgaaccgagccatcggtgcgcctatcaatatctggaatgaccac
agcgactcgatgagccagcgtgattccggatggctgcaactgtttgctgaaaacaaccaa
gaggccgcggacctgcacgtgcaggcgtttcgcatcgcggaggaactcagcgtaccggtg
atggtgtgcatggacgggtttatcctcacccacgcggtcgaacaggtcgacctgcccgaa
tcggaacaggtcaaacagttcctgcccccttatgaaccccgtcaagtactggacccggac
gatccgctctctatcggggcaatggtcggtcccgaagcctttaccgaagtgcgctatatc
gcccaccacaagatgctgcaggccttggacctcattccgcaggtacagtctgagtttaag
agtatttttgggcgagattccggcggtttgctgcacacctaccgttgcgaggacgccgaa
accatcattgtggcgctgggctccgtggtcggcacgctcaaggacgtggttgatcagcgg
cgtgagaatggcgaaaagattggcattatgtctctcgtgtccttccggcccttccccttc
gcggccatccgtgaggtgttgcaaagcgcgaagcgcgtggtgtgtctcgaaaaagccttc
cagctggggattggcgggattgtttcttccgagctgcgcgcggcgatgcgcggactgcct
ttcacctgctacgaagttattgctgggttgggtgggcgcaacatcaccaagaattccctg
cacgccatgctggatcaggccgtggcagacaccatcgagcctctgaccttcatggacttg
gacatggaactggtgcaaggagaactggagcgagaagccgctacccggcgctccggcgct
tttgccaccaacctgcaacgcgaacgggtgctgcgcgccaacgcaaaaattgccgaagcc
ggtccgaaacccaaggcggacaaggtcggcaacccgcgcgtggcttccccgtccatcaag
caagacgccgtcccggtagtgcccgaccaggccgaataa

DBGET integrated database retrieval system