KEGG   Mobiluncus curtisii: HMPREF0573_10720Help
Entry
HMPREF0573_10720  CDS       T01257                                 

Definition
(GenBank) thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0573_10720
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_10720
   00620 Pyruvate metabolism
    HMPREF0573_10720
   00640 Propanoate metabolism
    HMPREF0573_10720
   00650 Butanoate metabolism
    HMPREF0573_10720
  Energy metabolism
   00680 Methane metabolism
    HMPREF0573_10720
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF0573_10720
Enzymes [BR:mcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF0573_10720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
841720..842871
Genome map
AA seq 383 aa AA seqDB search
MTEITQSTQTEIPAREQVKFYQVGSFAVGNRLADLQWRSLQSDPNRKNSLTSGHRACQGC
GEALGARYAIDTATTAAKGKMVAINATGCLEVFSTPYPETAWTIPWMHSLFGNAAAVAAG
AAAGLKAMGKDDIRVVAQGGDGGTVDIGMACLSGMFERNDDVLFICYDNEAYMNTGVQRS
GATPAAARTATTQPVGEHPGNVFTQGKDMPRIAMAHEIPYVATATVADLRDLEYKVQKAM
TYRGARYLHVLVPCPLGWGSNSNLTVTLARLAIQTGLFPVYEAENGEITSVTKIRRPAPV
EAYLKPQRRFAHVFKGPDSREVLARIQAIADRNIKRYGLIEMDSLDEDVRERILSAPDDP
AGRFAAALPGRQVMDVSNEPETD
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatcacgcaatctacacagaccgaaattccggctcgcgaacaggtcaagttc
tatcaagtcggctccttcgcggtcggtaaccggttggcagacctgcagtggcgttccctg
caatccgacccgaaccggaaaaactccttgacttccggacaccgcgcctgtcagggctgt
ggtgaagcgttgggagctcgctacgcgattgataccgctacgactgccgccaaaggcaaa
atggtggcaatcaacgcgaccggctgcttggaagtgttttcgaccccgtacccggaaacc
gcgtggacgattccctggatgcactccctgtttggcaacgccgctgcggtggcagccgga
gcggccgcgggtttgaaagctatgggcaaagacgacattcgtgtggtcgcccaaggcgga
gacggtggcaccgtcgatattgggatggcttgcttatccggcatgtttgaacgtaacgac
gacgtcctgtttatctgttacgacaacgaagcctatatgaacaccggggtgcagcgttcc
ggggcaaccccggcggcggcacgcaccgcgacgactcagccggtcggcgaacatcccggc
aacgtgtttacccagggtaaagacatgccgcggattgcgatggcacacgagattccttac
gtcgccaccgcgaccgtagcggatttgcgtgacttggaatacaaggtgcaaaaggcgatg
acttaccgcggagcgcgctacctgcatgttttggtgccctgtccgctggggtggggttca
aactcaaacttgacggtcactttggctcgtttggcgattcagaccgggctgttccccgtg
tatgaagcggagaacggagagattacttccgtcaccaagattcgtcgtcctgccccggtc
gaggcttacttgaagccgcagcgtcgtttcgctcacgtcttcaaaggtccggattcgcgc
gaagtgttggcgcggattcaagccattgccgaccgaaacattaaacgttacggcttgatt
gagatggattcactggacgaggacgtgcgggaacgtatcttgagtgctcccgatgacccg
gcgggacgttttgctgcggcactgcccgggcggcaggtaatggacgtcagcaacgaaccc
gaaaccgactaa

DBGET integrated database retrieval system