KEGG   Mobiluncus curtisii: HMPREF0573_10730Help
Entry
HMPREF0573_10730  CDS       T01257                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mcu  Mobiluncus curtisii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0573_10730 (hemG)
Enzymes [BR:mcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HMPREF0573_10730 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854399..855940
Genome map
AA seq 513 aa AA seqDB search
MTDEGFDMIILGGGLGALAAGYAATKRGLRPLILEERGRPGGLVCSGVFGGATVDIGAES
YATRTPEVTELCQELGLHPVAPHSDSWVWDHGRNDAVRIPFGTLGIPADLDDPVFVEGLT
HIAGPQALERARQDLTLPAEVGADAKSFGEMVEARLGKDVLDAFVTPFAGGIHSTHPYGL
DPDRVAPGLRATLARTGSLTKAVAATRKPNSVVVMMPAGGMFRLVDELVKRIIAAGGRID
NHVRVMHVETGIGADNPRWVVWCKHTISNTKFQGGPPEEIGNAFGLATDRIVVALPGNSA
LKVLNSAAASMLRLKYHAEREHRDATVRFDAAALEEIGDLTTGFQLHKGTHVMNVTLAVN
APQLDNPPRGSGMLVGPPPCGPDEDPNVLQAKAITNYSAKWPETMAGAAPHTHILRISYG
REGDPEGFVYQVSVERALADASRMLGVELTMDQVLDSRRIFWGDAMAHPTVEERAVLNQI
AAAAERVEGLDLEGALFAGTGITAVVARGLKFQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaaggcttcgacatgattatcctcggcggcgggctcggcgcgctggctgct
ggatacgcggcgacaaaacgcgggctgcgccccctcatcttggaggaacgcgggcgcccc
ggcggtctggtctgctcgggagtctttgggggagccaccgtggacatcggagccgagtcc
tacgctacccgcacccccgaagtcacggagctgtgtcaggaactgggcttgcacccggtt
gccccccacagcgactcctgggtatgggatcacggtcgcaatgatgccgtgcggattccg
tttggcacgctgggcattcccgccgaccttgacgacccggtgttcgtggaggggctgact
cacatcgccggaccacaggccctggaacgcgctcgacaggatttgacgctgcccgcagaa
gtcggcgcagacgcgaaaagttttggagaaatggtcgaagcccggctgggcaaagacgtg
ctggatgcgttcgtgaccccattcgcgggaggcattcactcaacacacccctacggatta
gatcccgaccgagtggcaccaggattgcgtgccaccctggcgcgcaccgggtcgttgacc
aaggcggtggctgccacccgcaaaccgaactcggtagtggtgatgatgcccgcaggcggc
atgtttagactggtggatgagctggtgaaacgcattatcgcggcggggggacgcatcgat
aaccacgtgcgcgtcatgcacgttgaaaccggtatcggcgcggacaacccgcgttgggtc
gtgtggtgcaaacacacgatttccaacaccaagttccagggcggtcccccggaagaaatt
ggtaacgctttcggtttggcgaccgatcgaatcgtggtggcgctgccgggcaacagtgcg
ttgaaagtgctgaactcggcggcggcctcgatgctgcgtctgaagtatcacgccgaacgt
gaacaccgggacgccaccgtacggtttgacgcggcggctttggaagaaatcggcgatttg
accaccggatttcagctgcataaaggcactcacgtgatgaatgtgactctggcggtcaat
gcgccccagctggacaatccgccgcgcgggtcaggcatgttggtcggtcccccgccctgc
ggacctgatgaggacccgaacgtcctgcaggccaaagccattacgaactattccgcgaaa
tggcccgagacgatggcaggagctgctccccacacgcatatcctgcggatttcctacggt
cgggagggcgacccggaaggcttcgtgtatcaggtgagtgtggagcgggctttggcagac
gcgtcgcggatgctgggggtggaactgaccatggatcaggtcctggattcgcgccgcatc
ttttggggcgacgctatggctcaccctaccgtcgaggaacgcgcggtgctcaaccagatt
gccgctgccgccgaacgcgtagagggcttggatctggaaggcgcgctgtttgctggaacc
gggattaccgccgtggtcgcacgcggattgaagtttcaatag

DBGET integrated database retrieval system