KEGG   Mobiluncus curtisii: HMPREF0573_10820Help
Entry
HMPREF0573_10820  CDS       T01257                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0573_10820 (gpmA)
   01230 Biosynthesis of amino acids
    HMPREF0573_10820 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0573_10820 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0573_10820 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0573_10820 (gpmA)
Enzymes [BR:mcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0573_10820 (gpmA)
Exosome [BR:mcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0573_10820 (gpmA)
  Exosomal proteins of melanoma cells
   HMPREF0573_10820 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(956168..956902)
Genome map
AA seq 244 aa AA seqDB search
MTYKLVLLRHGESEWNAKNLFTGWVDVPLSEKGRAEATHGGELLKKEGILPDVLHTSLLR
RAIMTANLALDACDRHWIPVHRSWRLNERHYGALQGLNKKAIRDEYGEDLFMQWRRSYDV
PPPQIELGSEFSQDADPRYAGEPIPRAECLKDVLERALPYWKDAVIPDLKTGKTVMVAAH
GNSLRAIVKHLDSISDDEISGLNIPTGIPLYYELGGDFKPVSHGRYLDPDAAANAIKAVA
NQGK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaaacttgtgttgctccgccacggcgagagcgaatggaatgcaaaaaacctg
tttaccgggtgggttgacgtgcctttgagtgaaaaggggcgcgccgaagctacccacggc
ggtgagctgcttaagaaggaaggcatcctgcctgacgtcttacacacttccctgctgcgc
cgcgcgattatgaccgctaacttggcattggacgcgtgcgaccggcactggattccggtg
caccgctcgtggagattgaacgaacggcactacggtgccctgcagggcttgaacaagaaa
gctatccgcgatgaatacggcgaggatttgttcatgcagtggcgccgttcctatgacgtg
ccgccgccccagattgaactcggttccgagtttagccaggacgccgatccacgttacgcc
ggcgagccgattccgcgggcggaatgtctcaaggacgtgctggaacgtgctctgccctac
tggaaggatgcagtcatcccagaccttaagaccggcaagaccgtcatggtggcagcccac
ggcaactcgctgcgcgccattgtgaagcacttggattccatcagcgatgatgagatttcg
ggtctgaacattcccaccgggattccgctgtactacgagctgggcggagactttaagcct
gtctcgcacggtcgctacctggatccggatgcagccgccaatgcgattaaagcagtggcg
aatcagggcaaatag

DBGET integrated database retrieval system