KEGG   Mobiluncus curtisii: HMPREF0573_10889Help
Entry
HMPREF0573_10889  CDS       T01257                                 

Gene name
cheB
Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mcu  Mobiluncus curtisii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HMPREF0573_10889 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HMPREF0573_10889 (cheB)
Enzymes [BR:mcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     HMPREF0573_10889 (cheB)
Two-component system [BR:mcu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   HMPREF0573_10889 (cheB)
Bacterial motility proteins [BR:mcu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HMPREF0573_10889 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027726..1028853
Genome map
AA seq 375 aa AA seqDB search
MAGIKVLVVDDSVVVRKIVTDALNADPSLEVVGTAPNGKLALMKWKQLKPDAITMDIEMP
EMDGIEAVRELRKMGCKDPIIMFSTLTQRGATATLEALSAGATDYVTKPANQGSVQQSIQ
SVREQLVPIILGLLPSKVRAIGAVSANLSPEARANISSVPTMFAGPLKLHDRTGMPDKPI
RIVILGSSTGGPEALTKVISGLSRPMPIPMVITQHMPPVFTTQLAARLDKLTSATVQEAS
EGMMLAPGHIYLAPGNFHMTFAGNAGAPRVKLTQTPPVNFCRPSVDVMFDSAVNLYGGDM
LAVVLTGMGQDGKNGCGKVLEAGGRTLVQDEQTSVVWGMPGAVANAGFADEIRPLDEIAT
QIQRHVQAYAPEARR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggctggcattaaagtcctcgtggtggacgattctgtcgtggtgcgcaagattgttacg
gatgcgctcaacgctgaccccagtctggaggtcgtaggtactgccccgaacggcaaactg
gcgctgatgaagtggaaacagctaaagcctgatgccatcacgatggacatagaaatgccc
gaaatggacggtattgaggcggtgcgcgagctgcgcaagatgggctgtaaagaccccatc
atcatgttctccaccctgacccagcgtggcgcgaccgcgactttggaagccctctctgcc
ggcgctacggactacgtgacgaaaccggctaaccagggttccgtccagcagtccattcaa
agtgtgcgggaacagctggttcctatcattttgggcttgctgcccagcaaagttcgcgcg
attggggcggtctctgccaatttgtcccccgaggcgcgcgccaatatttcttccgtgccg
accatgtttgccggtccgctcaaactccacgaccgtacgggtatgccggacaagccgatt
cgtatcgtcattctcggttcttccaccggcggtcccgaagctttgaccaaggtgatttcc
ggattgagccgtcccatgccgattccgatggtcatcacccagcacatgcccccggtgttt
accacccagttggcggcgcgtttggacaagctgacttccgcgacggtgcaggaggcttcg
gaaggcatgatgttggcgccgggtcacatttatctggcaccgggcaacttccatatgact
tttgccggcaatgccggggctccacgcgtgaaattgacccagaccccgccggtaaacttt
tgccgtccttccgtggacgtcatgtttgactccgcggtgaatctctatggcggagatatg
ttggcagtcgtgctgactggcatgggtcaggacggcaagaacggctgtggcaaggttttg
gaagcaggaggacgcaccctggtgcaggacgaacagacttctgtggtttgggggatgccg
ggggcggtagctaacgcgggctttgcagacgaaatccgaccgctagatgagattgccacc
cagattcagcgccacgtccaggcttatgctccggaggccagacgatga

DBGET integrated database retrieval system