KEGG   Mobiluncus curtisii: HMPREF0573_10985Help
Entry
HMPREF0573_10985  CDS       T01257                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
mcu  Mobiluncus curtisii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0573_10985 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    HMPREF0573_10985 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0573_10985 (lacZ)
Enzymes [BR:mcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF0573_10985 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1147308..1150370
Genome map
AA seq 1020 aa AA seqDB search
MQLPNHHQNLNVLHENTVAPRAYYIPVSPEVARAPAQIPNFNLDRERSDRFQLLNGVWKF
GFYPCVEDVPEDFFTPGAAGLPDTIPTPGAWQYHGYDSHQYTNINYPFPFDPPYVPHTNL
AGAYRHEFHYQPDPQAPDATLVFEGVDSCFYLWLNGRYVGYSQVSHTVSAFEVTEFLREG
TNTLAVLVCKWSDGSYLEDQDKFRCSGIIRDVYLLKRPAVHLNDYFLTTEIQPNGAGVKL
RANFRGEPCPVTVTLTDGPNIVGQTELHPLCDGDETYTHATEFHLEHPKLWNPGAPRLYT
MVMESAHEVITERVGIRTVTITDAVLKMNGNPIKIKGVNRHESEAQTGPVVSLAQMKRDL
ELMRQHNINAVRTSHYPNCPQFYHLCDELGFYVMSEADNESHGTRNRVLTDETEENVVEL
WNKPIADNPEWIPAILDRVQRCVHSEKNRPCVFSWSAGNECAYGVTVETALQWIKDFDPT
RVTHYESAYHRSRDRTYDYHNIDLYSRMYPLLSDITDYLDNLGDKPFLLVEYCHAMGNGP
GDLEDYWALVQADARMCGGFIWEWCDHAVPDADGRLLYGGDSGEYPHDGNFCVDGLVSPD
RTPHIGLWEVKNVYRPLRFSYDQKAGLLRATNMADHLNTADFATLKWVRARDGAEDSGAI
ELPPLAPHQSVEIPLSMDVPAGGRCFLRVETYLSRPFACLETGHLLGFDEFALDNADPRC
LPARQLSQELRTIPAPHAPHIETSPKEITIELGAYTYVFSRFTGMLTDWRGRAGALLTRP
MELNIWRAPTDNDAYIRTRWERAHYDRCTPYAYSVEVVSGTSMVVKSQVALVAPSIQPIL
KADLEWVLGDDGALRMNASVTRDTQFPELPRLGWRIFLDQDFTQADWSGLGPHENYLDKR
RSAWHGRFCSPVRDLFQHYLRPQENGSRCSCDYLKLSGENASLEVVSGAEFSFNASHFTQ
EELGAKAHDYELVEVPETVLCLDHRMAGIGSQSCGPKLQECYQVAAPHYEFSFTLKCSSN
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaccaaatcaccaccagaacctcaacgttttacacgaaaatactgtggcgccg
cgggcttactacattccggtttcccccgaggtcgcgcgcgccccggcgcaaatcccgaat
ttcaacctggaccgtgagcgttcagaccgtttccagctgctcaacggtgtgtggaagttc
ggattctatccctgcgtagaggacgtgccggaggattttttcactcccggagctgcgggg
cttcccgacacgattcccacacccggcgcgtggcagtaccacggttacgactcccaccag
tacacgaacatcaactaccccttcccttttgaccccccttatgtgccccataccaacctc
gctggcgcttaccgtcatgagtttcactaccagccagatccgcaagcccccgatgccacc
ctcgttttcgagggcgttgactcgtgtttctacctgtggctgaacgggcgttacgtgggg
tattcacaagtctcccacacggtttccgcttttgaggtcaccgagtttctgcgagagggg
acgaatacgctggcggtactggtctgtaaatggtcggatggcagctacctggaagaccag
gacaagttccgctgttcgggcattatccgcgatgtctacctgctgaaacgccccgcggta
cacctcaacgattacttcctcaccaccgagatacagcccaacggtgccggcgtaaaactg
cgcgcgaatttccgtggggaaccctgcccggtcacggtaacgctcaccgacggccccaac
attgtggggcaaaccgagctacaccccttgtgcgatggggacgaaacctacacccatgcc
accgagttccacctcgaacacccgaaactgtggaatcccggcgcaccccgcctctatacc
atggtgatggaatctgcgcacgaagtcatcacggaacgggtcggcatccgtaccgtgacc
atcactgacgccgtgctgaaaatgaacggcaaccccatcaaaatcaaaggcgtaaaccgt
cacgaaagtgaagcgcaaaccggaccggtcgtctcgctagcccagatgaaacgggattta
gaactgatgcgccagcacaatatcaacgcggtgcgcacctcccactacccgaactgcccc
cagttctatcatctgtgcgacgagctgggattttacgtgatgagcgaagcggataatgaa
agccacggcacccgaaaccgcgtcctgaccgacgaaacggaagaaaacgtggtggagctg
tggaataaacccatcgcggacaacccggagtggattcctgccatcctggaccgggtccag
cgctgtgttcacagcgaaaagaatcgtccgtgcgtgttctcctggtcggcaggcaacgaa
tgtgcttacggggtaactgtcgaaaccgcgctgcagtggattaaagactttgaccccacc
cgggtgacgcactacgaaagcgcctatcatcggtcccgcgaccgcacttatgattaccac
aatatcgacctgtactcccgaatgtaccccctgctttccgacatcacagactacttggat
aatctcggcgacaagccattcctgctggtggagtactgtcacgcgatgggcaacggtccg
ggggatttagaggattactgggccctggtgcaggcagacgcgcgcatgtgcggcgggttc
atctgggaatggtgcgaccacgcggtgccagacgccgacggtcgtctgctctacggtgga
gactcgggggaatacccccacgacgggaacttttgcgtcgacgggctggtcagccccgac
cgcaccccgcatatcgggctgtgggaggttaaaaatgtgtaccgtcccttgcggtttagc
tatgaccaaaaggctgggttgctgcgggcgacaaatatggctgatcacctcaacaccgcc
gattttgccaccctaaaatgggtgagggcgcgagacggcgcggaggacagcggcgctatc
gagctgcccccgctggcgccccaccagagtgtagaaattcctctttccatggacgttcct
gccggcgggaggtgtttcctgagggtggaaacgtacctgtcccgtccgttcgcctgcctg
gagacggggcatttattggggttcgacgagtttgctctggataacgccgacccgcgctgt
ctgcctgcccgtcagctcagccaggaactccggaccattccggcacctcacgctccccat
atcgaaaccagtcccaaggaaatcacgattgagctgggcgcatacacctacgtgttttcc
cggttcaccggaatgctcaccgattggcgtggccgcgcgggggcgctcctgacccgaccg
atggaactcaacatttggcgtgccccgaccgacaacgacgcgtatatccggacgcggtgg
gagcgggcacactatgaccgttgcaccccctatgcctattcagtcgaggtggtgtccggc
accagtatggtggtgaaatcgcaggtagcgctggtggcgccgtcgattcagcccatttta
aaagcagacctggaatgggtattaggcgacgatggagccttgcggatgaacgccagcgtc
acccgtgatacgcagtttccggaactaccgcgcttgggatggcgaatcttcctggaccaa
gactttacccaagcggactggtcagggctgggaccgcacgaaaactacctcgacaaacgt
cgttctgcctggcacgggcgtttctgcagccccgttcgggacctgttccagcactatttg
cgcccacaagaaaacgggtcgcgctgctcctgtgactacctcaagttgagcggcgagaac
gccagtttagaggtggtgagcggggcggaattcagtttcaacgcgtcgcactttacgcaa
gaagaactgggggcgaaagctcacgattatgaactggtcgaggtcccggaaaccgtgctg
tgtctggatcatcgcatggcgggaatcggttcccaaagctgcggaccgaagttgcaggaa
tgctaccaagtcgccgcaccgcactacgaattttctttcactctcaagtgttccagcaat
tag

DBGET integrated database retrieval system