KEGG   Mobiluncus curtisii: HMPREF0573_11119Help
Entry
HMPREF0573_11119  CDS       T01257                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mcu  Mobiluncus curtisii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0573_11119 (glgB)
Enzymes [BR:mcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF0573_11119 (glgB)
Exosome [BR:mcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0573_11119 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1303042..1305264
Genome map
AA seq 740 aa AA seqDB search
MAKITVSPELLNQVAYANYYSPHSVLGPHSDGEDVTIRTVRHMAQSVTIVTEHGDFPAEH
EQDGVWVAVIPHAEVEDYRVKVTYGDQEVLGDDPYRFLPTLGEMDTYLISEGRHERLWDV
LGAHLKEYQGPLGVVKGVAFAVWAPNAQAVKVVGDFNFWDGSGCAMRSLGASGVWELFIP
GVEIGARYKYDIKGPDGNWRQKADPMARATEIPPATASVVTDQFHTWNDAEWMEQRATNV
DTHPIHTQPMSIYECHIGSWREGYGYRDLAEHLVPYVKEMGFTHVEFMPVAEHPYGPSWG
YQCTSYYAPTARFGTPDDFRYLVDALHQNGIGVILDWVPAHFPKDDWALAGFDGTALYED
PDPQRGQHPDWGTLVFNYGRREVKNFLVANALYWMEEFHIDGLRVDAVASMLYLDYSRKE
GQWHPNQYGGRENLEAIALLQEVTATCYRVCPGTVMIAEESTAWPGVTQPTSEGGLGFGF
KWNMGWMNDTLRYLAEDPVNRKWHHNELTFSLVYAFSENFVLPLSHDEVVHGKGSLLSKM
PGDYWRQLAGLRLLFAYQWTHPGKQLIFMGSEFGQGAEWNSGASLDWWHLDIPEHQGIRQ
LVTDLNHLYASNPALWCDDYRGFEWIEPSDADHNLITYLRRSVAESDPSGIESGHLLAVV
ANFSGNPHDPFRVGLPFAGQWDEVLNTDAEVYGGSGVGNLGQVTAEEIPWNNRPCSVSLR
IPPLGVVILRPAEDNPYRPR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatcaccgtttccccggaacttttgaaccaggtcgcctacgcgaactactac
tctccgcactcggtgctgggaccacactcggacggcgaggatgtcaccatccgcaccgtg
cgtcacatggcgcaaagcgtcaccatcgtcaccgaacacggtgacttccccgcggaacat
gaacaggacggggtgtgggtggcagtcatcccgcacgccgaagtcgaggactaccgggtg
aaagtcacctacggtgatcaggaagtcttgggggatgacccctaccgtttcctgccgacc
ttgggcgaaatggacacttacctgatttcagaagggcgtcacgagcgtctgtgggacgtt
ttgggtgctcatttaaaggagtaccagggtccgctgggggtcgtgaaaggtgtggctttc
gcggtgtgggcgccgaacgcacaagcggtgaaggtcgtgggggacttcaacttttgggac
gggtcggggtgcgcgatgcgcagcctcggggcatccggggtgtgggagctgttcattccc
ggtgttgagataggcgcacgctacaagtacgacattaaaggtcccgacgggaactggcgt
caaaaggctgacccgatggcgcgcgctacggagattcctcccgccaccgcctcggtggtc
actgaccagttccacacttggaacgatgcggagtggatggaacagcgtgccacgaacgtg
gacactcatccgattcatacccagcctatgagcatctacgaatgccatatcggctcgtgg
agagaaggctatggctaccgtgacctggcggaacacctggtgccttacgttaaggaaatg
ggtttcacccacgtggagttcatgcccgtggcggaacacccctacggaccgtcttggggg
tatcaatgcacgtcatactatgctccgaccgcccggtttgggacgcctgacgacttccgt
tacctggtggatgcgttgcaccaaaacgggattggcgtgattttggactgggttccggcg
cacttccccaaggatgactgggcgctggcggggttcgacggcacggctctgtacgaggac
cccgatccgcagcggggtcagcacccggactgggggacattggtattcaactacggtcgg
cgtgaagtgaagaacttcctggtcgctaacgccctgtactggatggaagagttccacatt
gacggtctgcgggtggacgcggtagcgtcgatgctctatctggattattcccgcaaagaa
ggtcagtggcacccgaaccagtacggtggacgggaaaacctcgaggctatcgccctgctg
caagaagtcaccgcgacctgctaccgggtttgccccggcacggtcatgattgccgaagaa
tcgaccgcctggcccggcgtcacccagccgacttccgaggggggtctgggttttggtttc
aagtggaacatggggtggatgaatgacactctgcgctacttggcagaggacccggtgaac
cgcaagtggcatcacaacgagctgacgtttagcctggtctacgccttttcagagaacttt
gtgctgccgctgtcccacgatgaggtcgtgcacggcaaaggctcgctgctgtccaagatg
cccggcgattattggcgccagttggcaggattgcgcctgctatttgcttaccagtggacg
catccgggcaagcagctcatcttcatgggctccgagtttggtcagggcgcggaatggaat
tcgggggcatccttggattggtggcacctggacattcccgagcatcaggggattcgtcaa
ctggtcaccgatttgaaccacctgtatgcgtccaacccggcgctgtggtgtgatgactat
cgcgggtttgagtggattgagcccagcgatgctgaccataacttgattacgtatctgcgc
cggtccgtggcggaatcggatccttcagggattgaatcgggtcacttgctggcagtggtg
gcgaactttagtggcaatcctcatgatccgttccgggtcggactgccgttcgctggtcag
tgggacgaggtgctaaacacggacgctgaagtttacggcggctccggcgtgggtaacctg
ggtcaggtcaccgctgaggagattccgtggaataaccgcccctgctcggtatctttgcgg
attcccccgctgggtgtcgtgattttgcgccccgccgaggataacccgtaccgcccgcgg
taa

DBGET integrated database retrieval system