KEGG   Mobiluncus curtisii: HMPREF0573_11196Help
Entry
HMPREF0573_11196  CDS       T01257                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mcu  Mobiluncus curtisii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF0573_11196 (glpK)
Enzymes [BR:mcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HMPREF0573_11196 (glpK)
Exosome [BR:mcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0573_11196 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1403517..1405055)
Genome map
AA seq 512 aa AA seqDB search
MSQKKYVMAIDQGTTSSRAIIFDHYGRIVSVGQMEHEQIFPSPGWVEHDASEIWFNVREV
VGRALANATKQTGMELNHHDIAALGITNQRETTIVWDKNTGQPIYNAIVWQDTRSQDLVD
RLAANGGPDRWRPIVGETLSTYASITKIMWILENVPEARERAERGELLFGNPDTWVIWNM
TGGINGGLHVTDVTNASRTMLMDLHTLQWREDICHEAGIPLSMLPEIRSSSEVYGQCRQD
GLLAGVPVAGDLGDQQAATFGQACFEPGMAKNTYGTGCFMLMNTGTTPMPSENGMITTVC
YKIGNESTVYALEGSIAVTGSLIQWLRDNLNIIEASDDVEDLASSVKDNGGVYFVPAFSG
LFAPYWKGDARGTIVGMTRYNTKAHLARAALEATAFQTREVLDAMESDSHVCLGELRVDG
GMTANNLLMQFQSDILGVPVVLPTVAETTALGAAYAAGIAVGFWSGTADVTNNWQEHYRW
NPTMDPTERDRTLRLWKKAVTRTFDWVDEDAR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaaaaaatatgtgatggcgattgaccagggcacgacttcgtctcgggccatt
atttttgaccactacggtcgcatagtttcggtcggtcagatggagcatgaacagattttt
ccatctcccggttgggtcgaacacgatgcttccgaaatctggttcaacgtgcgggaagtc
gtggggcgtgccctggctaacgccacgaaacaaactggaatggagctcaaccaccacgac
atcgctgccctgggcatcaccaaccagcgcgaaaccacgattgtgtgggacaaaaacacc
ggtcagcccatctataacgcgattgtgtggcaggatactcgttcccaagacctggtggat
cggttggcagcaaacggtggaccggatcggtggcgtccgatagtgggcgaaaccctgtcc
acctatgcgtctatcacgaaaattatgtggattttggaaaatgtgcccgaagcgcgggag
cgtgccgaacgaggcgagttgctgttcggcaacccggacacctgggtcatctggaacatg
accggaggcattaacggcggtctgcacgtcaccgacgtgaccaatgcttcgcgcaccatg
ctgatggaccttcacactttgcagtggcgtgaggacatttgtcatgaggccgggattccc
ttgagcatgttgcccgagattcgttcctcgtcagaagtttacggtcagtgtcgccaggat
ggtttgctggcaggggtgccggtcgccggagatttgggggatcagcaggccgcaaccttt
ggtcaggcatgtttcgagccgggaatggcaaagaatacctacggaaccggttgtttcatg
ctgatgaataccggcaccaccccgatgccctcggaaaacggcatgattaccacggtttgc
tacaagattggcaatgagtcgaccgtttatgcgttggagggatccatcgccgtgaccggc
tcgctgattcaatggctgcgggacaatctgaacattatcgaggcctccgatgacgtggaa
gatttggcttcttccgtgaaagacaacggcggagtctatttcgtgccggcattttccggg
ctgttcgcgccttactggaagggagatgctcgcgggacgattgtcggcatgactcgctat
aacacgaaagcacacctagcacgcgccgccctggaagccactgcattccaaaccagggaa
gtcttggacgcgatggagtcagattctcacgtgtgcctcggcgagttgcgcgttgacggc
gggatgacggcaaacaacctgctgatgcagtttcagtccgatattttgggcgtaccggtg
gtgttgcccacagtcgccgaaacgacggctctcggagcagcctacgccgccggtatcgcc
gtcggcttttggagtggtaccgcggacgtcaccaataactggcaggaacattaccggtgg
aaccccactatggacccgacagaacgagaccgcaccctgcgcttgtggaagaaagccgtg
acccggacttttgactgggttgacgaggacgctcggtaa

DBGET integrated database retrieval system