KEGG   Mobiluncus curtisii: HMPREF0573_11591Help
Entry
HMPREF0573_11591  CDS       T01257                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mcu  Mobiluncus curtisii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mcu00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mcu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1792799..1793965
Genome map
AA seq 388 aa AA seqDB search
MRKPCKEDKFSFGIWTVGWQGVDPFGVATREALDPWEYAEKLAELGAWGVTFHDNDVFDF
AASEQQRQDTIKRFKEACDGAGLVIEMVTTNTFTHPIFKDGGLTNNDREIRRFGLKKILK
NVDLAAEMGASTFVMWGGREGAEYDSSKDLNAAFERYKEGLDAVAGYIKEKGYNLRIGLE
PKPNEPRGDIFLPSVGHALALIAELENGDVVGLNPETGHEQMANLNYNHALAQALNAGKL
FHIDLNGQSGLKYDQDKCFGHGDLASAFFTVDLLVNGFPGGGNRYEGPIHFDYKPSRTEG
FEGVWASAAANMEMYLMLKEKALAFRADPLTKELMEAASVLELCKPTMNEGETYAEFMNS
PTVNPEQASQREYHFVELYQQAMRHLVG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagccatgcaaagaagataaattttccttcggtatttggacagttggttggcag
ggtgtggacccgtttggggtagccacacgtgaagcattggatccttgggaatatgccgaa
aagctcgccgagctaggtgcctggggtgtgacttttcacgataacgatgtgttcgatttt
gcagcaagtgaacaacagcgtcaagataccataaagagatttaaagaagcctgcgacggg
gcaggattagttattgaaatggttacgaccaacacatttactcatcctatttttaaggac
ggagggttgacgaacaatgaccgggaaattcgtcgcttcggcctcaagaaaattctgaaa
aacgttgacttggctgcggaaatgggcgcctcgactttcgttatgtggggaggtcgcgaa
ggtgccgagtacgattcctccaaggatcttaacgccgcttttgaacggtacaaggaaggc
ttagatgctgttgcgggctacattaaagaaaaaggctacaacttgcgcatcggactggaa
cccaagccaaatgaacctcgcggtgacatcttcctgccctcagttggtcatgctctggca
ttaattgctgagctggaaaatggggacgtcgtgggtctgaacccagaaacaggtcatgaa
caaatggctaatctgaactataaccacgctttggcacaagcgctgaatgctggaaagctt
ttccacattgatttgaacgggcaatctgggctgaaatatgaccaggataaatgcttcggt
cacggagacttggcatctgctttcttcacagtggatttgctggtcaatgggttccccgga
ggcggaaatcgttatgaaggtccaattcattttgattataagccctctcggactgaggga
tttgaaggtgtttgggcttccgcggcggcgaacatggaaatgtatctaatgcttaaggaa
aaagctctcgcattccgcgcggatccacttactaaggaacttatggaagcagcttccgtg
ttggagctgtgcaaacctaccatgaacgagggtgaaacttacgcggaatttatgaacagc
cctaccgttaacccggaacaggcatcgcaacgtgaatatcactttgtagagctgtaccaa
caggctatgcgtcaccttgtgggatag

DBGET integrated database retrieval system