KEGG   Mobiluncus curtisii: HMPREF0573_11605Help
Entry
HMPREF0573_11605  CDS       T01257                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcu  Mobiluncus curtisii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0573_11605
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_11605
  Amino acid metabolism
   00310 Lysine degradation
    HMPREF0573_11605
Enzymes [BR:mcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HMPREF0573_11605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1809280..1809495)
Genome map
AA seq 71 aa AA seqDB search
MPALGESVTEGTVTKWLKNVGDPVALDEPLLEVSTDKVDTEIPSPIAGTITQIVITEDET
VDVGTVLAYIG
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgccagccctgggtgagtccgtcaccgaaggcactgtcaccaaatggctgaaaaacgtc
ggcgaccctgtcgccttagacgaacctctcctggaagtctccaccgacaaagtcgacacc
gagattccctcccccattgctggcaccatcacccaaatcgtcatcactgaagacgaaacc
gtagacgtcggcaccgtcctcgcctacatcggttag

DBGET integrated database retrieval system