KEGG   Mobiluncus curtisii: HMPREF0573_11605Help
Entry
HMPREF0573_11605  CDS       T01257                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcu  Mobiluncus curtisii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0573_11605
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0573_11605
  Amino acid metabolism
   00310 Lysine degradation
    HMPREF0573_11605
Enzymes [BR:mcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HMPREF0573_11605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1809280..1809495)
Genome map
AA seq 71 aa AA seqDB search
MPALGESVTEGTVTKWLKNVGDPVALDEPLLEVSTDKVDTEIPSPIAGTITQIVITEDET
VDVGTVLAYIG
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgccagccctgggtgagtccgtcaccgaaggcactgtcaccaaatggctgaaaaacgtc
ggcgaccctgtcgccttagacgaacctctcctggaagtctccaccgacaaagtcgacacc
gagattccctcccccattgctggcaccatcacccaaatcgtcatcactgaagacgaaacc
gtagacgtcggcaccgtcctcgcctacatcggttag

DBGET integrated database retrieval system