KEGG   Mobiluncus curtisii: HMPREF0573_11661Help
Entry
HMPREF0573_11661  CDS       T01257                                 

Gene name
trpC1
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mcu  Mobiluncus curtisii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcu01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mcu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1871430..1872278
Genome map
AA seq 282 aa AA seqDB search
MLTYEEFYRQAKAGVALREATVPLELVKEQARHAPSPKDGLAVLHSRPGFVAIMGEIKRQ
TPTAGFLNPIEDPVELAREYIEGGAVAVSVVTDHPNYLGTTEDFVQVRQALDVPLLRKEY
VVTPYQIHESRAMGADMVLLMVALLEPIVLESLVERTHSLGMCALVECHSRLEARQAISA
GARLIGINARNRETGAVDRSMCEQTIDVIPPDITVVAESGVHGPQEVFDYARVGADAILV
GEALVRSPDPVNLLRKMTSAAQHPALRPDRASRYRHNTEGHE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgctgacttatgaggagttttaccgtcaagccaaagctggggttgccctgcgcgaggcc
acagtgcctttggaactcgtcaaagagcaggctcgtcacgctcccagcccaaaagacggc
ttggcggtgctgcactcccgtcccggttttgtcgccatcatgggggaaatcaaacggcaa
actccgaccgctggttttctcaatcccattgaagatccggtggaattagccagggaatac
atcgaaggcggggcagtagcggtttctgtggtgacggatcatcctaactacctggggacg
acagaggactttgtacaggtccgtcaggctctggacgtgccgctgctgcgcaaggaatat
gtggtcactccctatcagattcacgagtcgcgggcgatgggcgcggatatggtgctgctg
atggtggctttgctggaaccgatagtattggaatcgttggtggaacggacacattcattg
ggaatgtgcgctttggtagagtgtcattctcgtttggaggcgcggcaggctatttcggcc
ggggcacgtctcatcggtatcaacgctcggaaccgagaaacgggtgcggtagatcgctcc
atgtgcgagcaaactattgacgtcattcctcccgacatcaccgtggttgcggaatctggg
gtgcatggtccacaggaagtctttgattatgctcgggtcggggctgatgccatcttggtc
ggtgaagcgctggtgcgttctcctgacccggtgaatctgttgcgcaagatgacttctgca
gcgcagcatcctgctttgcgtcccgatcgggcatcccggtatcgccataacactgaaggt
cacgagtaa

DBGET integrated database retrieval system