KEGG   Mobiluncus curtisii: HMPREF0573_11661Help
Entry
HMPREF0573_11661  CDS       T01257                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcu01100  Metabolic pathways
mcu01110  Biosynthesis of secondary metabolites
mcu01130  Biosynthesis of antibiotics
mcu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0573_11661 (trpC)
Enzymes [BR:mcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HMPREF0573_11661 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE ThiG His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADI67980
UniProt: D6ZH72
Position
1871430..1872278
Genome map
AA seq 282 aa AA seqDB search
MLTYEEFYRQAKAGVALREATVPLELVKEQARHAPSPKDGLAVLHSRPGFVAIMGEIKRQ
TPTAGFLNPIEDPVELAREYIEGGAVAVSVVTDHPNYLGTTEDFVQVRQALDVPLLRKEY
VVTPYQIHESRAMGADMVLLMVALLEPIVLESLVERTHSLGMCALVECHSRLEARQAISA
GARLIGINARNRETGAVDRSMCEQTIDVIPPDITVVAESGVHGPQEVFDYARVGADAILV
GEALVRSPDPVNLLRKMTSAAQHPALRPDRASRYRHNTEGHE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgctgacttatgaggagttttaccgtcaagccaaagctggggttgccctgcgcgaggcc
acagtgcctttggaactcgtcaaagagcaggctcgtcacgctcccagcccaaaagacggc
ttggcggtgctgcactcccgtcccggttttgtcgccatcatgggggaaatcaaacggcaa
actccgaccgctggttttctcaatcccattgaagatccggtggaattagccagggaatac
atcgaaggcggggcagtagcggtttctgtggtgacggatcatcctaactacctggggacg
acagaggactttgtacaggtccgtcaggctctggacgtgccgctgctgcgcaaggaatat
gtggtcactccctatcagattcacgagtcgcgggcgatgggcgcggatatggtgctgctg
atggtggctttgctggaaccgatagtattggaatcgttggtggaacggacacattcattg
ggaatgtgcgctttggtagagtgtcattctcgtttggaggcgcggcaggctatttcggcc
ggggcacgtctcatcggtatcaacgctcggaaccgagaaacgggtgcggtagatcgctcc
atgtgcgagcaaactattgacgtcattcctcccgacatcaccgtggttgcggaatctggg
gtgcatggtccacaggaagtctttgattatgctcgggtcggggctgatgccatcttggtc
ggtgaagcgctggtgcgttctcctgacccggtgaatctgttgcgcaagatgacttctgca
gcgcagcatcctgctttgcgtcccgatcgggcatcccggtatcgccataacactgaaggt
cacgagtaa

DBGET integrated database retrieval system