KEGG   Mobiluncus curtisii: HMPREF0573_11692Help
Entry
HMPREF0573_11692  CDS       T01257                                 

Definition
dolichyl-phosphate beta-D-mannosyltransferase (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
mcu  Mobiluncus curtisii
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913233..1913979)
Genome map
AA seq 248 aa AA seqDB search
MKNTNYNAQTVIAIPTYNERENLEWITTEVLAQAPGIHILIVDDNSPDGTGELADALAAN
HPQLHVLHRTGKEGLGPAYLAAFAWADSHGYSWVGEFDADGSHQPRDLPRLLALAHGSGR
PDLVIGSRWRRGGATSGWSLPRQALSRAGSVYVNVVLGLGVADTTAGFRVYRVDFLSRLL
QRYVIESKGYGFQIEMTWRTRRAGGKIVEVPITFVERRAGTSKMSGSIIKEAFLEVAKWR
IRELCQRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacactaactataacgcgcagaccgttatcgctatcccgacctataacgagcga
gaaaacctcgagtggattaccacagaggttttggcgcaagcgccaggaattcacatcctc
atcgtggatgataattcacctgatgggacgggggaattggcagacgctttagctgcgaat
cacccgcagcttcatgtgttgcaccgcacgggtaaggagggtctgggaccggcttatttg
gcagcatttgcctgggcggatagccacggatacagctgggttggggaattcgatgcagat
ggttcgcaccagcctcgggatttaccgcgtctgttggctttagctcatggtagcggtcgt
ccggacctggtcatcggatcgcgctggcggcgtgggggagcgacctcagggtggtcgctc
ccgcgtcaggcgctgagccgggcgggaagcgtttatgtcaatgtggtgctgggattgggc
gtagctgacaccacagcgggtttccgggtctatcgggtggatttcctgtcccgtttattg
cagcgttacgtcattgaatcaaaagggtacggtttccagattgagatgacctggcggacg
cgccgggcggggggcaagattgtggaagtgcccattacctttgtggaacgccgggcaggt
acttcgaaaatgagcgggtcaatcattaaggaagcgttcctagaagtcgccaagtggcgg
atacgggaactatgccaacgtgcctag

DBGET integrated database retrieval system