KEGG   Mobiluncus curtisii: HMPREF0573_11692Help
Entry
HMPREF0573_11692  CDS       T01257                                 

Definition
dolichyl-phosphate beta-D-mannosyltransferase (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
mcu  Mobiluncus curtisii
Pathway
Metabolic pathways
Brite
Enzymes [BR:mcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     HMPREF0573_11692
Glycosyltransferases [BR:mcu01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   HMPREF0573_11692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913233..1913979)
Genome map
AA seq 248 aa AA seqDB search
MKNTNYNAQTVIAIPTYNERENLEWITTEVLAQAPGIHILIVDDNSPDGTGELADALAAN
HPQLHVLHRTGKEGLGPAYLAAFAWADSHGYSWVGEFDADGSHQPRDLPRLLALAHGSGR
PDLVIGSRWRRGGATSGWSLPRQALSRAGSVYVNVVLGLGVADTTAGFRVYRVDFLSRLL
QRYVIESKGYGFQIEMTWRTRRAGGKIVEVPITFVERRAGTSKMSGSIIKEAFLEVAKWR
IRELCQRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacactaactataacgcgcagaccgttatcgctatcccgacctataacgagcga
gaaaacctcgagtggattaccacagaggttttggcgcaagcgccaggaattcacatcctc
atcgtggatgataattcacctgatgggacgggggaattggcagacgctttagctgcgaat
cacccgcagcttcatgtgttgcaccgcacgggtaaggagggtctgggaccggcttatttg
gcagcatttgcctgggcggatagccacggatacagctgggttggggaattcgatgcagat
ggttcgcaccagcctcgggatttaccgcgtctgttggctttagctcatggtagcggtcgt
ccggacctggtcatcggatcgcgctggcggcgtgggggagcgacctcagggtggtcgctc
ccgcgtcaggcgctgagccgggcgggaagcgtttatgtcaatgtggtgctgggattgggc
gtagctgacaccacagcgggtttccgggtctatcgggtggatttcctgtcccgtttattg
cagcgttacgtcattgaatcaaaagggtacggtttccagattgagatgacctggcggacg
cgccgggcggggggcaagattgtggaagtgcccattacctttgtggaacgccgggcaggt
acttcgaaaatgagcgggtcaatcattaaggaagcgttcctagaagtcgccaagtggcgg
atacgggaactatgccaacgtgcctag

DBGET integrated database retrieval system