KEGG   Mobiluncus curtisii: HMPREF0573_11702Help
Entry
HMPREF0573_11702  CDS       T01257                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00030  Pentose phosphate pathway
mcu00040  Pentose and glucuronate interconversions
mcu01100  Metabolic pathways
mcu01110  Biosynthesis of secondary metabolites
mcu01120  Microbial metabolism in diverse environments
mcu01130  Biosynthesis of antibiotics
mcu01200  Carbon metabolism
mcu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0573_11702 (rpe)
   00040 Pentose and glucuronate interconversions
    HMPREF0573_11702 (rpe)
Enzymes [BR:mcu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     HMPREF0573_11702 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ADI68021
UniProt: D6ZHB3
Position
complement(1925277..1925939)
Genome map
AA seq 220 aa AA seqDB search
MSLKIYPSVLNCDQMHFAKALQDIKSADGVHLDIMDNHFVPNLTWGLPTATAVLNSTRLP
VDAHLMIENPDRWSLEYAKAGCAIVCFHLEASRAPIRTADVLHSLGAKVGIALNPATPAS
AIKDILGRFDQVTVMSVEPGFGGQKFIPEVLPKIRQLRAYAEDARLPLDIEVDGGINDDT
LPLVLQAGANVVVAGSYVFKRNPEQAIATLRTIGATDHTH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagccttaagatttatccctccgtgctgaactgtgaccagatgcattttgccaaagcg
ttgcaagacattaaaagcgctgatggggttcatctcgatattatggacaatcactttgtg
cccaacctgacgtggggactgcccaccgccacggcggtgttaaactccaccagactgccg
gttgatgcccacctgatgattgaaaatccagaccgttggtccttggaatatgccaaggct
ggctgcgcaatcgtctgtttccacctggaagcctcccgtgccccgatacgaaccgcagac
gtactgcacagcttgggcgccaaagttggcattgcgttgaatccagcgacccctgccagc
gccattaaagatattttgggacgctttgaccaagtgacagtcatgagtgtggagccgggc
tttggggggcaaaagtttatccctgaggttcttcccaagattcgccagctgcgcgcatat
gccgaagacgcccgcttgcccctcgacattgaagttgacgggggaattaacgatgatacc
ttgcctcttgtgctgcaagccggagcaaatgtggtggtggcagggtcctatgtgttcaag
cgcaaccccgaacaggctatcgccacgttgcgcaccattggtgcaaccgaccatacccat
tag

DBGET integrated database retrieval system