KEGG   Mobiluncus curtisii: HMPREF0573_11702Help
Entry
HMPREF0573_11702  CDS       T01257                                 

Gene name
rpe
Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mcu  Mobiluncus curtisii
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mcu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcu01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mcu00030]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mcu00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1925277..1925939)
Genome map
AA seq 220 aa AA seqDB search
MSLKIYPSVLNCDQMHFAKALQDIKSADGVHLDIMDNHFVPNLTWGLPTATAVLNSTRLP
VDAHLMIENPDRWSLEYAKAGCAIVCFHLEASRAPIRTADVLHSLGAKVGIALNPATPAS
AIKDILGRFDQVTVMSVEPGFGGQKFIPEVLPKIRQLRAYAEDARLPLDIEVDGGINDDT
LPLVLQAGANVVVAGSYVFKRNPEQAIATLRTIGATDHTH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagccttaagatttatccctccgtgctgaactgtgaccagatgcattttgccaaagcg
ttgcaagacattaaaagcgctgatggggttcatctcgatattatggacaatcactttgtg
cccaacctgacgtggggactgcccaccgccacggcggtgttaaactccaccagactgccg
gttgatgcccacctgatgattgaaaatccagaccgttggtccttggaatatgccaaggct
ggctgcgcaatcgtctgtttccacctggaagcctcccgtgccccgatacgaaccgcagac
gtactgcacagcttgggcgccaaagttggcattgcgttgaatccagcgacccctgccagc
gccattaaagatattttgggacgctttgaccaagtgacagtcatgagtgtggagccgggc
tttggggggcaaaagtttatccctgaggttcttcccaagattcgccagctgcgcgcatat
gccgaagacgcccgcttgcccctcgacattgaagttgacgggggaattaacgatgatacc
ttgcctcttgtgctgcaagccggagcaaatgtggtggtggcagggtcctatgtgttcaag
cgcaaccccgaacaggctatcgccacgttgcgcaccattggtgcaaccgaccatacccat
tag

DBGET integrated database retrieval system