KEGG   Mobiluncus curtisii: HMPREF0573_11829Help
Entry
HMPREF0573_11829  CDS       T01257                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mcu  Mobiluncus curtisii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mcu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2061854..2062819)
Genome map
AA seq 321 aa AA seqDB search
MPELPEVETIRRNLEQTVVGARVLGASDPTHERTLRNQQGGITGLRAGLVGARLGAAVRR
GKFLWFPLLGDTPREKGPLALVMHLGMSGQLRVESRGATLHRKEAAASPQAAPQHSRETR
LLPHERLRFTLDNEKDLVFCDQRTFGHVELRPLQPTADGAPGGMGAPEPLLPQGVEHIAR
DVLDPCRDTTDFVKKTHASTRAIKTKLLDQSIVSGIGNIYADEGLFAARIHPAAPGRSLS
DRKLRKLLGAVAAVMEQALVFGGTSFDRLYVNSWGNPGEFAKELQVYGRGGQSCHRCGTR
LDKMIIDGRSSVFCPRCQRKR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttcccgaagtggagacaattcgccgtaatctggagcaaaccgtggtgggt
gcgcgggttctcggtgccagcgaccccacccatgagcgtactttgcgcaatcagcagggg
ggaatcacagggttgcgcgcaggactggtgggggcgcgtctgggcgcggcagtacgacgc
ggaaagtttttgtggtttcctttgctaggggatacccccagggaaaaaggtccgcttgcc
ctcgtgatgcacctgggtatgtcgggacagctgcgagtggaatctaggggcgcgactttg
caccgtaaagaggcagccgcgtcaccacaagccgctccgcagcattcgagagagactcga
cttttgcctcatgaacgccttcgcttcactctcgacaatgagaaagacctggtattttgc
gaccagcgcacctttggtcatgtcgaactccgaccgttgcaacccaccgcggatggtgct
cccggagggatgggtgccccggaaccgctgctaccgcagggcgtggaacatattgcccgc
gatgtgctcgatccgtgccgagatacaacagatttcgtgaaaaaaactcatgccagcacg
cgagcaatcaaaaccaagttgttggatcagagcattgtctccggtatcggaaacatttat
gcagatgaaggcttatttgctgcccggatacatcccgctgctcccggtcggtcgctcagc
gataggaaactgcggaaattgctaggtgccgtggcggcggtgatggaacaggcgttggtc
tttgggggtacttcatttgaccgcttatacgtgaattcttggggcaatccaggcgaattc
gcaaaagaattgcaggtttacggacggggtggacaaagttgccaccgctgcgggacacgg
ctcgataagatgattattgacggtcgctccagcgtgttttgtccacgctgccagcgaaag
cgttag

DBGET integrated database retrieval system