KEGG   Mobiluncus curtisii: HMPREF0573_11853Help
Entry
HMPREF0573_11853  CDS       T01257                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mcu  Mobiluncus curtisii
Pathway
mcu00340  Histidine metabolism
mcu01100  Metabolic pathways
mcu01110  Biosynthesis of secondary metabolites
mcu01230  Biosynthesis of amino acids
Module
mcu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mcu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    HMPREF0573_11853 (hisD)
Enzymes [BR:mcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HMPREF0573_11853 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADI68172
UniProt: D6ZHR4
Position
complement(2087100..2088431)
Genome map
AA seq 443 aa AA seqDB search
MFNLLDFSKEDVDAAVLRERLPRAALDVEQAVAAVTPLIEAVRREGAKALRDQSEQFDRV
RPRLLRVPETQIDRALQELDPALREAIETSIANNRKGHEAQLPHPVVTEIIPGGTVTQRW
IPARRVGLYVPGGLAVYPSSVIMNVVAAQVAGVDQIALASPAQRAFDGSVHPTVLATCAL
LGVREVYAMGGAGAIGAFAYGAKGETADDGQVLVEPVDVVTGPGNIYVAAAKRVVSSVCG
IDAEAGTTEIAIIADSSATPKFVAADLISQAEHDPAAASVLITDSTELVTQVRAELERQI
PQRDHHERIVTALSGPQSGTILTRDIEQSIAVANAYGAEHLEIQTADAREVAAKIHNAGA
IFVGDYTPVPLGDYLAGSNHVLPTGGTASHASGLNVMAFLKSVQQIEYTQQAADALTDRL
VVFSHAEDLEGHGASLLARREGK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaacttattggatttttcaaaagaagacgttgatgctgcagtgctgcgcgagcgc
cttccacgggcagccctcgacgtagagcaggctgtggcggcggtaacgcccctgattgaa
gcggtgcgtcgggaaggcgccaaagccttgcgagaccaatccgagcagttcgaccgggtc
cgcccgcgcctgttacgagttccagagactcaaattgaccgcgccttgcaggaactggat
ccggcgctgcgcgaagcgattgaaacttccattgccaataaccgcaaaggtcacgaggca
cagttgccccacccggtcgtcaccgagattattcccggtggtactgttacgcagcgttgg
attccggcgcggcgcgtgggactgtacgttccgggcgggctggcagtctatcccagctcg
gtcatcatgaatgtggtggcagcacaagtggcgggggtggaccagattgctctggcctcc
ccggcacagcgggctttcgacggctcggtacacccgaccgtgctggcgacctgcgcctta
ttaggagtgcgtgaagtctatgccatgggcggggcaggcgcgattggtgcatttgcctac
ggcgcgaaaggagagaccgcagatgacggtcaggttctggtggagcctgtggacgtcgtt
accggtccgggcaatatctatgtcgcggcggcgaaacgtgtggtatccagtgtctgcggt
atcgacgccgaagccggtaccaccgagattgccatcatcgcggatagcagcgccactccg
aaatttgttgctgcagatttaatcagccaagccgaacacgaccccgcagccgcctcggtc
ctgattaccgactcgaccgaacttgtgacccaggtgcgcgccgaactggaacgccaaatt
ccccaacgcgaccaccacgaacgcatcgtcactgccctatccgggccacaatcgggcact
atcctcactcgggatattgaacaatccattgccgtggcaaacgcgtacggcgctgaacac
ctcgagattcaaaccgctgatgctcgcgaggtggcagcaaaaatacacaatgcgggggca
atctttgtcggtgactacaccccggtgcccctgggggactacctagcaggctccaaccac
gtcttgcccaccggaggcacggcctcccacgcttcgggactgaacgtgatggcattctta
aagtctgtgcaacagattgaatacacccagcaagctgcggatgcgctgaccgaccgcctg
gtggtattcagtcatgccgaggacctggaaggtcacggagcgtccctgctggcacgtcgg
gaaggcaaataa

DBGET integrated database retrieval system