KEGG   Mycobacterium canettii CIPT 140070008: BN43_10070Help
Entry
BN43_10070        CDS       T02420                                 

Gene name
celA
Definition
Possible cellulase CelA1 (endoglucanase) (endo-1,4-beta-glucanase) (FI-CMCASE) (carboxymethyl cellulase) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64096..65112
Genome map
AA seq 338 aa AA seqDB search
MMSSAIGSVARWIVPLLGVAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPAS
AAMVAARNANPPNAELTSVANTPQSYWLDQAFPAATVGGTVASYTGAAQAAGAMPVLTLY
GIPHRDCGSYASGGFATGADYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQER
FDLVRYAVDALTRDPAAAVYVDAGHSRWLSAEAMAVRLNDVGVGRARGFSLNVSNFYTTD
EEIGYGEAISGLTNGSHYVIDTSRNGAGPAPDSPLNWCNPSGRALGAPPTTATAGAHADA
YLWIKRPGESDGTCGRGEPQAGRFVSQYAIDLAHNAGQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtcgtcagctattggttcggtcgcgcggtggatagtccccctcctgggggttgca
gccgttgcttccatcggtgttatcgcggacccggtgcgggtcgttcgggccccggcgttg
atcctggtcgatgcggcaaacccgctggccggaaagcccttctacgtcgatcccgcctcg
gcggccatggtcgccgcgcgcaacgccaacccgccgaacgccgagctgacctccgtcgcc
aacaccccgcagtcctactggctcgaccaggcattcccggcggcgaccgtaggcggcacg
gttgccagctacaccggcgcggcgcaggctgccggcgccatgccggttctgacgctttat
ggaatcccccatcgcgactgcggtagctacgcatccggtgggttcgcgacgggcgctgac
taccgcgggtggatcgacgccgtcgcatccggcctgggctcatcgcctgcaacgatcatc
gtcgaacccgacgcgctcgccatggccgactgcctgtcgcctgaccagcgccaagaacgt
ttcgacttggtgcgctacgccgtcgacgcactgacccgtgacccggccgctgccgtgtac
gtcgatgcggggcattcgcgctggctgagcgccgaggcaatggcagtcaggctcaacgac
gtcggtgtgggccgcgcgcgcgggtttagcctcaacgtctcgaacttctacaccaccgat
gaggaaatcggttacggcgaggcgatttcggggctcacgaacggttcgcattacgtgatc
gacacgtcgcgcaacggcgccggaccagcacccgactccccgctcaactggtgcaacccc
agcggccgcgccctgggcgcaccgcccaccacggccaccgcgggcgcgcacgccgacgct
tacctgtggatcaaacgtcccggcgaatccgacggaacctgcggtcgcggcgagccccag
gcgggtcggttcgttagccagtacgccatcgatctggcccacaacgcgggccagtag

DBGET integrated database retrieval system