KEGG   Mycobacterium canettii CIPT 140070008: BN43_10372Help
Entry
BN43_10372        CDS       T02420                                 

Gene name
aspC
Definition
Putative aspartate aminotransferase AspC (transaminase A) (ASPAT) (EC:2.6.1.1)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mcv01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcv01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mcv00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:mcv00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(400262..401551)
Genome map
AA seq 429 aa AA seqDB search
MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRAVVTRYELVPGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQ
PDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGIGLLANMR
LCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgatggcaccattgtggacgtgacaacccaccagctgccctggcacaccgcc
agccatcagcggcagcgcgccttcgctcagtcggccaagctgcaggacgtcctgtacgag
atccgcggcccggtgcaccagcacgccgcgcggctcgaagccgaaggtcaccgcatcctc
aaactcaacatcggcaacccggcgccgttcggcttcgaagcacccgacgtgatcatgcgc
gatatcatccaggcgctgccctacgcgcaggggtactccgactcgcagggcatcctgtcg
gcccggcgtgcggtggtcacgcgctacgagctggtgcccggatttccccgattcgacgtg
gacgacgtctacctgggtaacggggtctccgagctgatcacgatgacgctgcaagccctg
ctggacaacggcgatcaggtgctgattccatcaccggactacccgctgtggacggcgtcg
acctcgctggctggcggcactccggtccactacctgtgcgatgagacccaaggctggcag
cccgatatcgccgacctggaatccaagattaccgagcgcaccaaggcgctggtcgtgatc
aaccccaacaacccaaccggcgcggtgtacagctgcgaaatcctcacccagatggtcgat
ctggcccgcaagcatcaactgctgctgttggcggacgaaatctacgacaaaatcctctac
gacgacgccaagcacatcagcctggcatcgatcgccccggatatgttgtgcctgaccttc
aatgggctgtcgaaggcctaccgcgtcgccggataccgggccggctggctggcgatcacc
ggacccaaagagcacgccagcagcttcatcgagggcatcggcctgctggccaatatgcgg
ttgtgcccaaatgtcccggcccagcatgccattcaggttgcactgggcggccatcagagc
atcgaggacctggtgctgcccggcggccggctgctcgagcagcgcgacatcgcctggacc
aagctcaacgagatcccgggggtgtcgtgcgtcaaaccggcgggcgcgctgtatgcgttt
ccccggctagaccccgaggtctacgacatcgacgacgacgagcaactcgtgctcgatctg
ctgctgtcggagaagatcctggtcacccagggcaccgggttcaactggcccgcaccggat
catctgcgcctggtgacgctgccatggtcccgcgatctggcggccgccatcgagcggctg
ggtaacttcctggtcagttaccggcaatag

DBGET integrated database retrieval system