KEGG   Mycobacterium canettii CIPT 140070008: BN43_10506Help
Entry
BN43_10506        CDS       T02420                                 

Gene name
icl
Definition
Isocitrate lyase Icl (isocitrase) (isocitratase) (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN43_10506 (icl)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN43_10506 (icl)
Enzymes [BR:mcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BN43_10506 (icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
555838..557124
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL
HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgtcggcaccccgaagagcgcggagcagatccagcaggaatgggacacgaac
ccgcgctggaaggacgtcacccgcacctactccgccgaggacgtcgtcgccctccagggc
agcgtggtcgaggagcacacgctggcccgccgcggtgcggaggtgctgtgggagcagctg
cacgacctcgagtgggtcaacgcgctgggcgcgctgaccggcaacatggccgtccagcag
gtgcgcgccggcctgaaggccatctacctgtcgggctggcaggtcgccggcgatgccaac
ctgtccgggcacacctaccccgaccagagcctgtatcccgccaactcggtgccgcaggtg
gtccgccggatcaacaacgcactgcagcgcgccgaccagatcgccaagatcgagggcgat
acttcggtggagaactggctggcgccgattgtcgccgacggcgaggccggctttggcggc
gcgctcaacgtctacgagctgcagaaagccctgatcgccgcgggcgttgcgggttcgcac
tgggaggaccagttggcctctgagaagaagtgcggccacctgggcggcaaggtgttgatc
ccgacccagcagcacatccgcactttgacgtctgctcggctcgcggccgatgtggctgat
gttcccacggtggtgatcgcccgtaccgacgccgaggcggccacgctgatcacctccgac
gtcgacgagcgcgaccagccgttcatcaccggcgagcgcacccgggaaggcttctaccgc
accaagaacggcatcgagccttgcatcgctcgggcgaaggcctacgccccgttcgccgac
ttgatctggatggagaccggtaccccggacctcgaggccgcccggcagttctccgaggcg
gtcaaggcggagtacccggaccagatgctggcctacaactgctcgccatcgttcaactgg
aaaaagcacctcgacgacgccaccatcgccaagttccagaaggagctggcagccatgggc
ttcaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttcgat
ctggcctacggctacgcccagaaccagatgagcgcgtatgtcgaactgcaggaacgcgag
ttcgccgccgaagaacggggctacaccgcgaccaagcaccagcgcgaggtcggcgccggc
tacttcgaccggattgccaccaccgtggacccgaattcgtcgaccaccgcgttgaccggt
tccaccgaagagggccagttccactag

DBGET integrated database retrieval system