KEGG   Mycobacterium canettii CIPT 140070008: BN43_10556Help
Entry
BN43_10556        CDS       T02420                                 

Gene name
hemD
Definition
(GenBank) Putative uroporphyrin-III C-methyltransferase HemD
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00860  Porphyrin and chlorophyll metabolism
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
Module
mcv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN43_10556 (hemD)
Enzymes [BR:mcv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BN43_10556 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN43_10556 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: CCK54456
Position
600993..602690
Genome map
AA seq 565 aa AA seqDB search
MTIMTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVLALIGTDL
PPVSGPAPAEPVAGNGDAAGGGSAQEQGRAASAVVSGGPDIRPALGDPADVAKTLTAEAR
SGVDVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVA
DVRGDVDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVE
TTLQGLTDPAVLGAADPACSANGRDSQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLV
PRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTSTNA
VRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDDFPP
YDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIKTGG
FDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGPLVD
ALAEHAARLRAEGALPPPRKKSRRR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcatgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctcc
ggtccgggcgaccccggcttgcttacgacacgggctgccgcggtgctggccaacgccgcg
ctggtgttcaccgatcccgacgtaccggagccggtgctggcgctgatcggcacggatctg
ccccccgtgtccggcccggcgcccgccgagccggttgccgggaacggcgatgcggccggc
ggaggaagtgcgcaggaacaaggccgggccgcgtccgcggtagtctccggtggtcctgac
atccgcccggcgctgggcgatcccgccgatgtggccaagacgctgaccgccgaggcccgt
tcgggtgtcgacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtaatc
agcgaggtgaacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggcc
gccagcagcgcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgcc
gacgtgcgcggcgatgtggactgggacgcgctggctgccgcacccgggccgctgatcctg
caggccaccgcatcgcatctagccgaatcggcccgcagcctgatcgatcaccagctggcc
gagtccactccgtgcgtggtgaccgcacacggcaccacctgtcagcagcgttcggtcgag
accacacttcagggattgaccgacccggcagtcctgggcgctgccgaccccgcgtgctcc
gcaaacgggagggactcccaggccggaccgctgatagtgaccatcggcaagacggtgacc
agtcgggcaaagctgaactggtgggagagccgcgctctctacggctggacggtgttggtg
ccgcgcaccaaggaccaggccggcgagatgagcgagcggctcacgtcgtacggcgcgctg
ccggtggaggtgccgaccatcgccgtcgagccgccgcgcagccccgcgcagatggagcgc
gccgtcaagggcctggtcgatggccgattccagtggatcgtgttcacctccaccaacgcg
gtgcgtgcggtgtgggagaagttcggcgagttcggtttggatgcccgcgcgttctccggg
gtgaagatcgcctgtgtcggcgagtcgacggccgaccgggtgcgcgccttcggaatcagt
cccgagctggtgccctccggggagcagtcctcgcttggcttgctagacgacttcccgccc
tacgacagcgttttcgacccggtgaaccgggttttgctgccgcgcgccgacatcgccacc
gaaacgctggccgagggactgcgagagcgtggctgggagatcgaggacgtcaccgcctac
cggaccgtgcgggccgcgccgccgccggccactacccgggaaatgatcaagacgggcggg
tttgacgcggtatgtttcacctccagctcgacggtgcgaaacctggtcggcatcgccggc
aagccgcacgcgcggacgatcatcgcctgcatagggccaaagaccgccgagaccgcagcc
gagttcggcttgcgggtcgatgtccagccggacaccgccgccatcggcccgctggtcgat
gcgctggccgagcatgccgcccggttgcgcgctgagggtgcgctgcccccgccgcgcaag
aagagccgcaggcgctag

DBGET integrated database retrieval system