KEGG   Mycobacterium canettii CIPT 140070008: BN43_20051Help
Entry
BN43_20051        CDS       T02420                                 

Gene name
recD
Definition
Putative exonuclease V (alpha chain) RecD (exodeoxyribonuclease V alpha chain) (exodeoxyribonuclease V polypeptide) (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN43_20051 (recD)
Enzymes [BR:mcv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BN43_20051 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(718324..720051)
Genome map
AA seq 575 aa AA seqDB search
MTLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRA
GSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREE
EQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTI
ARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVT
LHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRGGDGDAVLGLLRSG
EERIEFVDDEDPAPRLRTVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVL
HWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISG
ASGPLDVATGRLGDVVTMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKR
KVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCD
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcaccgacgtcgattttgccgtcgaggcctccgggatggtgcgggccttcaac
caggccggtgtgctggacgtgtcggatgtgcatgtggcgcaacgtctctgtgcactggcc
ggggagagcgacgagcgggtggcgttggcggtagcggtggcggtccgcgcgctacgggcc
ggttcggtgtgtgtggatctgttgtcgatcgcgcgggtcgctggacacgacgacctgccg
tggccggatccggcggactggttggcggcggtgcgggccagtccgttgctcgccgatcca
cccgtgctgcacctgtatgacgatcggctgctctatctggaccgctactggcgcgaagaa
gagcaggtgtgcgcggacctgctcgcgttgctgacatccaggcgaccggccggggtaccc
gacttgcggcgactgttcccgaccggctttgacgagcagcggcgcgcggcggaaatcgcg
ctctcgcaaggtgttacggtgttgaccggcgggcctggcaccgggaagacgacgacgatc
gcgcggctgctggcgttggttgccgagcaggcggagctggccggtgagccgcggccgcgg
atcgcgctggccgcacccaccggcaaggcggcggcccggctggccgaggcggtacggcgc
gagatggccaagctcgacgccaccgaccgggcacggctcggcgacctgcacgcggtcacg
ctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgccaggatcgccagaaccgg
ttgcctcacaacgtgatcgtggtcgacgagacctcgatggtgtcgctgacgctgatggcc
cggctggccgaggcggtgcgcccgggcgcccggttgatcctcgtcggcgatgccgaccag
ttggcgtcggtggaagccggagcggtgctggcggatttggtcgatggcttctcggtacgc
gacgacgcgctggtggcgcagctgcgaacgtcgcatcggttcggcaaggtgatcggtacc
ttggccgaagcgatccggggtggcgatggcgatgccgtactgggcctgctgcgctcgggt
gaggagcggatcgagttcgtcgacgacgaggatccggcgccgcggttgcgcacggtgctg
gtgccacacgcgttgcggctgcgcgaggcggcgctgttgggtgcctccgacgtcgcgttg
gccaccctggacgagcaccggctgctgtgtgcgcatcgggacgggcccaccggcgtgctg
cactggaaccgccgggttcaagcctggctcgccgaggagaccggccagccgccctggacg
ccgtggtacgccgggcgtccgctgctggtgacggccaacgactacggccttcgcgtctac
aacggcgacaccggtgtcgtgctggccggccccaccggtctgcgggccgtcatttctggt
gcatccgggccacttgacgttgccaccggccgcctcggcgacgtcgtgaccatgcacgcg
atgaccatccataagagtcagggcagccaggtcgacgaggtgacggtgctgatgccgcaa
gaggattcgcggttgctgacccgggagttgctgtacaccgcggtgacccgagccaaacgc
aaggtccgggtggtcgggtccgaagcttcggtgcgggccgcgatcgcgcgccgggcggtg
cgggccagcgggttgcggatgcggttacagtcgacggggtgtgactga

DBGET integrated database retrieval system