KEGG   Mycobacterium canettii CIPT 140070008: BN43_20311Help
Entry
BN43_20311        CDS       T02420                                 

Gene name
fadB
Definition
Putative fatty acid oxidation protein FadB
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN43_20311 (fadB)
   01212 Fatty acid metabolism
    BN43_20311 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN43_20311 (fadB)
   00650 Butanoate metabolism
    BN43_20311 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BN43_20311 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BN43_20311 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN43_20311 (fadB)
   00310 Lysine degradation
    BN43_20311 (fadB)
   00380 Tryptophan metabolism
    BN43_20311 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN43_20311 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN43_20311 (fadB)
   00281 Geraniol degradation
    BN43_20311 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BN43_20311 (fadB)
Enzymes [BR:mcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN43_20311 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN43_20311 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN43_20311 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
949923..952085
Genome map
AA seq 720 aa AA seqDB search
MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AQKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAADFKGVDFVIEAVFENQELKH
KVFGEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGS
QAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWPGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDEGVLTSTA
DANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVARARELAAAYGDRFLPPESLLS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaacacaattcagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaaaaccttcttcgccggcggcgacgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagaca
ctgggtaagccggtcgtcgcggccatcaacggggcggcgttgggcggcggcctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgtcaagggcagccagctcggcctgccg
gaggtgacgctgggtctgctgccgggtggcggtggggtgacccgcacggtacggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcttggataaaggaggagctcaaggccaaccccgacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtccttcccgtcgaacctgcgcaagcagctcaagggtgcgccgatgccggcg
cctcgggccatcctggccgccgcggtcgagggggcacaggtcgacttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggtcaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggtatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcttacgtgtcggccaaggccggctatgaggtggtgctcaaagatgtcagcctcgaggcc
gcgcagaaaggcaagggctactccgaaaagctggaggccaaggcgctggagcggggccgc
accacacaggagcgcagcgacgccctgctggcgcgcatcaccccgaccgccgacgccgcc
gatttcaagggtgttgatttcgtgatcgaggcggtttttgaaaaccaggagctcaagcac
aaggtgttcggcgagatcgaagacatcgtcgagcccaacgcgatcctgggatccaacacc
tcgacgctgccgatcaccggtctggcgaccggcgtcaagcggcaggaagactttatcggg
atccacttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acttctgacgaggccctggcccgggtgttcgactacaccttggccatcggcaagaccccg
atcgtggtcaacgacagccgcggctttttcacctcgcgggtcatcggcacgttcgtcaac
gaggcgctggcgatgctcggtgagggtgtcgagccggcttctatcgagcaggcggggtcg
caggccgggtatccggcgccgccgctgcagctgtccgacgagctcaacttggagctgatg
cacaagatcgccgtcgccacccgtaagggtgttgaggacgccggcggcacgtaccagccg
catccggcggaggccgtggtggagaagatgatcgagctcggccggtccggccggctgaag
ggcgcgggcttctacgagtacgccgacggcaagcgatccgggttgtggcccggcttgcgc
gagacgttcaagtcgggctcgtcgcagccgccgctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggaaacccagaagtgcctcgacgagggggtgctgacgtcgacggcc
gacgccaacatcggctcgatcatgggcatcggcttcccgccgtggacgggtggcagtgcc
cagttcatcgtcggctactccggcccggccggtaccggtaaggcggctttcgtggcccgg
gcccgcgagctggcggccgcctacggcgaccgcttcctgccaccggagtcgctgctaagc
tga

DBGET integrated database retrieval system