KEGG   Mycobacterium canettii CIPT 140070008: BN43_20428Help
Entry
BN43_20428        CDS       T02420                                 

Gene name
sucC
Definition
(GenBank) Putative succinyl-CoA synthetase (beta chain) SucC (SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00020  Citrate cycle (TCA cycle)
mcv00640  Propanoate metabolism
mcv00660  C5-Branched dibasic acid metabolism
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv01130  Biosynthesis of antibiotics
mcv01200  Carbon metabolism
Module
mcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN43_20428 (sucC)
   00640 Propanoate metabolism
    BN43_20428 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BN43_20428 (sucC)
Enzymes [BR:mcv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN43_20428 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Baculo_E25
Motif
Other DBs
NCBI-ProteinID: CCK54904
Position
1060730..1061893
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPSTPGRVTDTAEGAKAIATEIGRPVMVKAQVKIGGRGKAGGVK
YAATPQDAYEHAKNILGLDIKGHIVKKLLVAEASDIAEEYYLSFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVKGVDLDFARSIAEQGHLPAEVLDTAAVTIAKLWELF
VAEDATLVEVNPLVRTPDHKILALDAKITLDGNADFRQPGHAEFEDRAATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VVLGDQQVKSVFVNVFGGITSCDAVATGIVKALGMLGDEANKPLVVRLDGNNVEEGRRIL
TEANHPLVTLVATMDEAADKAAELASA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtatcaagccaaggagttattcgccaagcacaacgtgcccagcacg
ccgggtcgggtgaccgacacagccgagggtgccaaggctatcgccacggagatcgggcgt
ccggtgatggtcaaagcgcaggtcaagatcggcggccggggcaaggccggtggcgtcaaa
tacgccgcgaccccacaagacgcgtacgagcacgccaagaacatcctcggcctggacatc
aaaggacacatcgtcaagaaactgctggtcgctgaggctagcgatatcgccgaggagtac
tacctatccttcctgctcgaccgggccaaccgcacctacctggcgatgtgctcggtggag
ggcggcatggagatcgaagaggtagcggccaccaaacccgagcggctcgccaaagtcccg
gtgaatgccgtcaagggcgttgacctagatttcgcgcggtccatcgccgaacagggtcat
cttccggccgaggtgctcgacaccgcagcggtcaccatcgccaagctgtgggagctcttc
gtcgccgaggacgcgacgctggttgaggtcaacccgttggtgcggacgcctgaccacaag
atcctcgcgctggatgccaagatcaccctcgacggcaacgccgatttccgtcagcctggc
catgccgagttcgaggatcgagctgccaccgatccactggagttgaaggccaaggagcac
gacctcaactacgtcaagctggacggtcaggtggggatcatcggcaatggcgcgggcttg
gtgatgtcgactctcgacgtcgtcgcgtatgccggtgagaagcacggcggagtcaagccg
gccaacttcctggatatcggcggcggcgcttcggccgaggtgatggccgcgggtctggac
gtggtgctgggcgaccagcaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
tcgtgcgatgcggtggcgaccgggatcgtcaaggcgctgggcatgctgggtgacgaagcc
aacaagccgctggtggttcggctcgacggcaacaacgtcgaggaaggccgtcgcatcctg
accgaggccaaccaccccctggtgacactggtggcgacgatggacgaagccgccgacaag
gccgctgagctggcgagcgcctga

DBGET integrated database retrieval system