KEGG   Mycobacterium canettii CIPT 140070008: BN43_20436Help
Entry
BN43_20436        CDS       T02420                                 

Definition
Putative magnesium chelatase (EC:4.99.1.-)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mcv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1068649..1070028
Genome map
AA seq 459 aa AA seqDB search
MSPSNLPRTVGELRAAGHRERGVKQEIRENLLTALADGDNVWPGILGFDDTVIPQVERAL
IAGHDFVLLGERGQGKTRLLRALAGLLDEWTPVIAGAELGEHPYTPITPESIRRAAQLGD
DLPVAWKHRSERYTEKLATPDTSVADLIGDVDPIKVAEGRSLGDPETIAYGLIPRAHRGI
VAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPI
KDRFGAEIRTHYPLELEAEMGVIVQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGV
SARFAIAAAETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGREQAVL
EHLLRRATADTASRVLGGIDVGSLVTAVEGGSAVTTGERVSAKDVLAAVPGLPVVDRIAR
KLGAESEGERAAALELALEALYLAKRIDKVCGEGQTVYG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccagtaacctgccccgcaccgtgggcgagctgcgtgccgccggtcatcgggaa
cggggggtcaagcaggaaatccgggaaaatctgctgaccgcgctggccgacggcgacaac
gtctggccgggcatcctgggtttcgacgacaccgtgattccccaggtggagcgggccttg
atcgccggtcacgactttgtcctgctcggcgaacgcggccagggcaagacccggctgctg
cgcgcactcgcgggtctgctggacgagtggacgccggtgatcgccggcgccgaactgggc
gagcacccctacacgccgatcacgccggagtcgatccggcgggccgcgcagctcggcgac
gacctaccggtggcgtggaagcaccgcagcgagcgctacaccgagaagctggccaccccc
gacaccagcgtcgccgacctgatcggcgacgtcgacccgatcaaggttgccgagggccgc
agcctcggggatcccgaaaccatcgcctacgggctcatcccgcgggcgcaccgcggcatc
gttgcggtcaacgagctgcccgaccttgccgaacgcatccaggtgtcgatgctcaacgtc
atggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctggatgtgttg
gtggtcgccagcgccaaccccgaggactacaccaaccgtggccgcatcatcacgcccatc
aaggaccggttcggcgccgagatccgcacccactaccccctggagctggaggcggagatg
ggcgtcatcgtccaggaggcgcacctgagtgcacaggtgcccgactacctgatgcaggtg
ctcgcgcggtttgcccgttacctgcgagaatcccgctcgatcgatcagcgctccggggtg
tcggcgcggtttgccatcgcggcggccgaaaccgtggcggctgccgcccggcaccgcggg
gcggtgctgggggagacagacccggtggcccgggtggtcgatttgggcacggtgatcgac
gtgctgcgcggcaagctggaattcgagtccggcgaggagggccgcgaacaggcggtgctc
gagcatctgttgcgtcgcgccaccgccgataccgcgtcccgggtgctgggcggtatcgac
gttggctcgttggtgaccgcggtcgagggcggttcggcggtgacgacgggcgagcgggtc
tcggccaaggatgtgctggcggcggtgccgggcctgccggtggtggacaggatcgcgcgc
aagctgggcgccgaatccgagggggagcgggccgccgcgttggaattggcgttggaggcg
ctatatctcgccaagcgaatcgacaaggtctgcggggagggccagaccgtctatggctaa

DBGET integrated database retrieval system