KEGG   Mycobacterium canettii CIPT 140070008: BN43_31002Help
Entry
BN43_31002        CDS       T02420                                 

Gene name
adhA
Definition
Putative alcohol dehydrogenase AdhA (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BN43_31002 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN43_31002 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN43_31002 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BN43_31002 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN43_31002 (adhA)
   00626 Naphthalene degradation
    BN43_31002 (adhA)
Enzymes [BR:mcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN43_31002 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2127347..2128387
Genome map
AA seq 346 aa AA seqDB search
MVSPATMATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVGVHACGVCRTDLHVTEG
DLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDLGDRVGIAWLRHTCGVCKYCRRGSE
NLCPESRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELP
PGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALELGAASAQDAADRPPVPL
DAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQRHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaccggcgaccatggcgacgatgagtgcgtggcaggtgcgtcggcccggcccg
atggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatccgag
ttgctggtgggcgtgcacgcatgcggggtgtgccgcaccgatcttcacgtgaccgaaggt
gacctgcccgtacaccgcgaacgggtgattcccggccacgaggtagtgggagaggtcatt
gaggtgggctcagcggtgggcgcggctgccggtggcgaattcgacctaggagaccgggtg
ggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccgacgcggcagcgag
aacctctgtccggaatcccgctacaccggctgggacgccgacgggggatacgccgaattc
acgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgagctg
gcgccgttgttgtgcgctggcatcatcggatatcgatcgctgctgcgcaccgagctacca
cccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccaggtc
gcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaagctg
gcgctggaacttggcgccgcatcggctcaggacgccgccgaccggccacccgtgccgctg
gacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcgctg
gaccgtggcggcatcttggcgatcgccgggatccacctgactgatattccggacctgaac
taccagcggcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgcgcc
gatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccggag
tacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgccggc
gccgccgtgctgctgatctga

DBGET integrated database retrieval system