KEGG   Mycobacterium canettii CIPT 140070008: BN43_31434Help
Entry
BN43_31434        CDS       T02420                                 

Gene name
asnB
Definition
Putative asparagine synthetase [glutamine-hydrolyzing] AsnB (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mcv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2521029..2522987
Genome map
AA seq 652 aa AA seqDB search
MCGLLAFVAAPAGAAGPEGADAASAIARASHLMRHRGPDESGTWHAVDGASGGVVFGFNR
LSIIDIAHSHQPLRWGPPEAPDRYVLVFNGEIYNYLELRDELRTQHGAVFATDGDGEAIL
AGYHHWGTEVLQRLRGMFAFALWDTVTRELFCARDPFGIKPLFIATGAGGTAVASEKKCL
LDLVELVGFDTEIDHRALQHYTVLQYVPEPETLHRGVRRLESGCFARIRADQLAPVITRY
FVPRFAASPITNDNDQARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAIRH
NPRLITFTTGFEREGFSEIDVAVASAEAIGARHIAKVVSADEFVAALPEIVWYLDEPVAD
PALVPLFFVAREARKHVKVVLSGEGADELFGGYTIYREPLSLRPFDYLPKPLRRSMGKVS
KPLPEGMRGKSLLHRGSLTLEERYYGNARSFSGAQLREVLPGFRPDWTHTDVTAPVYAES
AGWDPVARMQHIDLFTWLRGDILVKADKITMANSLELRVPFLDPEVFAVASRLPAGAKIT
RTTTKYALRRALEPIVPAHVLHRPKLGFPVPIRHWLRAGELLEWAYATVGSSQAGHLVDI
AAVYRMLDEHRCGSSDHSRRLWTMLIFMLWHAIFVELSVVPQISEPQYPVQL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgctggccttcgtcgcggccccggccggtgctgcggggcccgaaggtgcc
gacgctgccagcgccatcgcccgcgcatcgcatttgatgcgccaccgcgggcccgatgaa
tcgggcacctggcacgccgtcgatggcgcctccggaggcgtcgtgttcgggttcaaccga
ctgtccatcatcgacatcgcgcactcgcatcagccgctgcggtgggggccgccggaggct
ccggaccgctacgtgctggtgttcaacggcgagatctacaactacttggagctgcgtgac
gagctgcgcacccagcacggcgctgtgttcgccaccgacggcgacggtgaggcgatcctc
gccggctatcaccactggggcaccgaggtgctgcagcggttgcgcggcatgttcgcattc
gcgctgtgggacaccgtcacccgcgaattgttctgcgcgcgagatccgttcggcatcaag
ccgttgtttatcgccaccggagccggcggcacggcggtggccagtgagaagaaatgcctg
ctggacctcgtcgagttggtggggttcgacaccgagatcgaccatcgggcgttgcagcac
tacaccgtcctgcagtacgtgccggaacccgagacactgcaccgtggggtacgtcggctg
gaatcaggctgcttcgcccggatccgtgccgaccagctcgcgccggtgatcacccgttat
ttcgtgccgcggtttgcggccagtccgatcaccaacgacaacgaccaggcccgctatgac
gagatcacggcagtgcttgaggactcggtggccaagcatatgcgcgccgatgtcaccgtc
ggcgcgtttctgtccgggggtatcgactccacggccatcgcggcgctggccatccggcac
aatccgcggctgatcaccttcaccaccggtttcgagcgcgagggcttctccgagatcgac
gtcgcggtggcttcggcagaggccatcggtgcccgtcacatcgccaaggtggtcagcgcc
gacgagttcgtcgccgccctgcccgagatcgtctggtacctcgacgagccggtcgctgac
ccagcgctggtaccgttgttcttcgtcgcccgcgaggcccgaaagcacgtcaaagtggtg
ttgtcgggcgaaggcgccgacgaactgttcggcggctacacaatctatcgagaaccgctg
tcgttgaggccgtttgactacctgcccaagccactgcgccggtcgatgggaaaagtttcc
aagccactgccggagggcatgcgcggcaagagtctgctgcaccgcggatcgctgacactc
gaagagcgctactacggcaatgcccgcagtttctccggcgcgcagctgcgcgaagtactg
cccgggttccggccggactggacccacacagatgtcacggcgccggtctacgccgaatcg
gccggctgggatccggtggcgcgaatgcagcacatcgacctgttcacctggctgcgcggc
gacattctggtcaaggccgacaagataacgatggccaactccctggagctgcgggtgccg
ttcctggacccggaggttttcgcggtggcctcccggttgccggcgggcgccaagatcacc
cgtaccaccaccaagtacgcgctgcggcgcgcgctggagcctattgtgcccgcacacgtg
ctgcaccggcccaagctcgggttcccggtcccgatccggcattggctgcgtgccggcgag
ctgctggagtgggcgtatgcgacggtgggctcgtcgcaggccggtcacttggttgacatc
gccgccgtgtatcgcatgctcgacgagcaccggtgcggcagcagcgaccacagccgccgg
ctgtggaccatgctgatctttatgctgtggcacgcgatcttcgtcgagctcagcgtggtg
ccccagatcagcgagccgcagtaccccgtccagttgtaa

DBGET integrated database retrieval system