KEGG   Mycobacterium canettii CIPT 140070008: BN43_31450Help
Entry
BN43_31450        CDS       T02420                                 

Gene name
dlaT
Definition
(RefSeq) DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN43_31450 (dlaT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN43_31450 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    BN43_31450 (dlaT)
Enzymes [BR:mcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN43_31450 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2537997..2539670
Genome map
AA seq 557 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVTRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAG
AAEGAPYVTPLVRKLASENNIDLAEVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAA
AAPAPKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGL
RARAKAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVD
TEQGLLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFD
TPILVPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLT
TIKHRLEEGAFEADLGL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcctctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcactcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcccccaagcccgcacccaagcccgtccccgag
ccagcgccgacgccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggt
gcggccgagggcgcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaac
atcgacctcgccgaggtgaccggcaccggagtgggtggtcgcatccgcaaacaggatgtg
ctggccgcggctgagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgcc
gccgcgccggccccgaaagcgccgcctgcccctgcgccggcgttggcacatctacggggc
accacccagaaggccagccggattcgtcagatcaccgccaacaagacccgcgaatctttg
caggcaacggcacagctgacacaaacccatgaggtcgacatgaccaagatcgtggggcta
cgggcccgggccaaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccg
ttcttcgccaaggccgtgatcgatgccctcaagattcacccgaacatcaacgccagctac
aacgaggacaccaaggagatcacctactacgacgccgagcacctaggattcgctgtcgac
accgagcagggcctgctctccccggtcatccacgacgccggcgatctgtcactggccggt
ctggcgcgggcgatcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgac
gagttgtccggcggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgac
accccgatcctggttccgccgcaggccgccatgctgggcaccggagcgatcgtcaagcgg
ccgcgggtggtcgtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctac
ctcccgttgacctatgaccatcggctcatcgacggcgccgacgccggacgtttcctcacc
acgatcaagcaccgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system