KEGG   Mycobacterium canettii CIPT 140070008: BN43_31450Help
Entry
BN43_31450        CDS       T02420                                 

Gene name
dlaT
Definition
(GenBank) DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00020  Citrate cycle (TCA cycle)
mcv00310  Lysine degradation
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv01130  Biosynthesis of antibiotics
mcv01200  Carbon metabolism
Module
mcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN43_31450 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    BN43_31450 (dlaT)
Enzymes [BR:mcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN43_31450 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CCK56251
Position
2537997..2539670
Genome map
AA seq 557 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVTRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAG
AAEGAPYVTPLVRKLASENNIDLAEVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAA
AAPAPKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGL
RARAKAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVD
TEQGLLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFD
TPILVPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLT
TIKHRLEEGAFEADLGL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcctctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcactcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcccccaagcccgcacccaagcccgtccccgag
ccagcgccgacgccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggt
gcggccgagggcgcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaac
atcgacctcgccgaggtgaccggcaccggagtgggtggtcgcatccgcaaacaggatgtg
ctggccgcggctgagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgcc
gccgcgccggccccgaaagcgccgcctgcccctgcgccggcgttggcacatctacggggc
accacccagaaggccagccggattcgtcagatcaccgccaacaagacccgcgaatctttg
caggcaacggcacagctgacacaaacccatgaggtcgacatgaccaagatcgtggggcta
cgggcccgggccaaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccg
ttcttcgccaaggccgtgatcgatgccctcaagattcacccgaacatcaacgccagctac
aacgaggacaccaaggagatcacctactacgacgccgagcacctaggattcgctgtcgac
accgagcagggcctgctctccccggtcatccacgacgccggcgatctgtcactggccggt
ctggcgcgggcgatcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgac
gagttgtccggcggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgac
accccgatcctggttccgccgcaggccgccatgctgggcaccggagcgatcgtcaagcgg
ccgcgggtggtcgtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctac
ctcccgttgacctatgaccatcggctcatcgacggcgccgacgccggacgtttcctcacc
acgatcaagcaccgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system