KEGG   Mycobacterium canettii CIPT 140070008: BN43_40349Help
Entry
BN43_40349        CDS       T02420                                 

Gene name
hemY
Definition
Protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mcv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3034762..3036120)
Genome map
AA seq 452 aa AA seqDB search
MTPRSYCVVGGGISGLTSAYRLRQAVGDDATITLFEPADRLGGVLRTEHIGGQPMDLGAE
AFVLRRPEMPALLAELGLSDRQLASTGARPLIYSQQRLHPLPPQTVVGIPSSAGSMAGLV
DDATLARIDAEAARPFTWQVGSDPAVADLVADRFGDQVVARSVDPLLSGVYAGSAATIGL
RAAAPSVAAALDRGATSVTDAVRQALPPGSGGPVFGALDGGYQVLLDGLVRRSRVHWVRA
RVVQLERGWVLRDETGGRWQADAVILAVPAPRLARLVDGIAPRTHAAARQIVSASSAVVA
LAVPGGTAFPHCSGVLVAGDESPHAKAITLSSRKWGQRGDVALLRLSFGRFGDEPALTAS
DDQLLAWAADDLVTVFGVAVDPVDVRVRRWIEAMPQYGPGHADVVAELRAGLPPTLAVAG
SYLDGIGVPACVGAAGRAVTSVIEALDAQVAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactccccgctcgtattgtgttgtaggaggcgggatttcgggattgacctcggcgtac
cggctgcggcaggctgtcggcgatgacgcgaccatcaccttgttcgaaccggccgatagg
ctcggcggggtattgcgcaccgagcatatcggcggacagccaatggacctcggcgcggag
gcgttcgtgctgcgtaggcccgagatgccggcgcttttggccgagctgggcctgtcggac
cgccaactcgccagcaccggcgcgcggccgctcatctacagccagcagcgcttgcacccg
ctgccgccgcagacggtcgtcgggatcccgtcgtcggcgggctccatggcggggctggtc
gacgacgcaaccctggcgcggatcgacgccgaagccgctcgtccgttcacctggcaggtg
ggcagcgatcccgcggtggccgacttggtggctgaccggttcggcgaccaagtcgtggcc
cggtcggtggacccgctgttaagcggggtatacgcgggctcggcggcgacgatcgggctg
cgcgcggccgccccgagcgtggccgcggccctggatcgcggggcgaccagtgtgaccgac
gcggtccggcaggcgctgccgccgggaagcggcgggccggtgttcggcgcgctggacggc
gggtatcaggtgctgctcgacgggctcgtccggcgcagccgggtgcactgggtgcgggcc
agggtggtccagctcgaacgcggctgggtgctgcgcgacgaaaccggcggccgctggcag
gccgacgccgtcatcctggcggttccggcgccgcggttggcgcgcctcgtcgatggcatc
gcgccgcgcacacatgccgccgcccggcagatcgtgagcgcgtcgtcggcggtggtggcg
ctggcggtgcccggcggcaccgcgtttccgcactgttccggcgtgctggtggccggcgac
gagtcaccgcatgccaaggcgatcacattgtcgtcgcgcaaatggggtcagcgcggcgac
gtcgcgctgttgcggctgtcgttcggtcggttcggcgacgaaccggccctgacggcctcc
gacgaccaactcctggcctgggcagcggacgacttggtcacggtgttcggtgtggccgtc
gacccggtcgacgttcgggtccggcgctggatcgaggcgatgccgcagtacggtcccggc
catgccgatgtggtcgccgagctgcgcgccggcctgccaccgacgctggccgttgcgggc
agctacctcgacgggatcggcgtgccggcctgcgtcggcgcggcgggccgggccgtcacc
agcgtcatcgaggccttagatgcgcaggtggcacgatag

DBGET integrated database retrieval system