KEGG   Mycobacterium canettii CIPT 140070008: BN43_40521Help
Entry
BN43_40521        CDS       T02420                                 

Gene name
echA
Definition
(GenBank) Putative enoyl-CoA hydratase Echa16 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
mcv00071  Fatty acid degradation
mcv00280  Valine, leucine and isoleucine degradation
mcv00281  Geraniol degradation
mcv00310  Lysine degradation
mcv00360  Phenylalanine metabolism
mcv00362  Benzoate degradation
mcv00380  Tryptophan metabolism
mcv00410  beta-Alanine metabolism
mcv00627  Aminobenzoate degradation
mcv00640  Propanoate metabolism
mcv00650  Butanoate metabolism
mcv00903  Limonene and pinene degradation
mcv00930  Caprolactam degradation
mcv01100  Metabolic pathways
mcv01110  Biosynthesis of secondary metabolites
mcv01120  Microbial metabolism in diverse environments
mcv01130  Biosynthesis of antibiotics
mcv01212  Fatty acid metabolism
Module
mcv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN43_40521 (echA)
   00650 Butanoate metabolism
    BN43_40521 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    BN43_40521 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN43_40521 (echA)
   00310 Lysine degradation
    BN43_40521 (echA)
   00360 Phenylalanine metabolism
    BN43_40521 (echA)
   00380 Tryptophan metabolism
    BN43_40521 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN43_40521 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN43_40521 (echA)
   00281 Geraniol degradation
    BN43_40521 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN43_40521 (echA)
   00627 Aminobenzoate degradation
    BN43_40521 (echA)
   00930 Caprolactam degradation
    BN43_40521 (echA)
Enzymes [BR:mcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN43_40521 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 AMMECR1 Flavodoxin_2
Motif
Other DBs
NCBI-ProteinID: CCK56872
Position
3175746..3176495
Genome map
AA seq 249 aa AA seqDB search
MTDDILLIETDERVRTLTLNRPQSRNALSAALRDQFFAALADAEADDDVDVVILTGADPV
FCAGLDLKELAGQTALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASEHARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSLTGDYLSAADALRAGLVTEVVAHDQLLP
TARRIAASIVGNNQNAVRALLASYHRIDESQTADGLWLEATAAKQFRTSGDTIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacatcctgctgatcgaaaccgacgaacgggtgcgcaccctcaccctcaac
cggccgcagtcccgcaacgcgctctccgcggcgctgcgggatcagttcttcgcggcgttg
gccgacgccgaggccgacgacgacgtcgacgtcgtcatcctcaccggcgccgatccggtg
ttttgcgccggactggacctcaaggaattggccgggcagaccgcgctgccggacatctca
ccgcggtggccggcgatgaccaagccggtgatcggcgcgatcaacggcgccgcggtcacc
ggcgggctcgaactggcgctgtattgcgacattctgatcgcctccgagcacgcccgcttc
gccgacacccacgcccgggtgggcctgctgcccacctggggactcagcgtgcgcttgccg
caaaaggtcggcatcggcctggcccggcggatgagcctgaccggtgactacctctcggcc
gccgacgcgttgcgcgccggcctggtcaccgaggtggtggcccacgaccagctgctgccc
accgcccgccggatcgcggcgtccatcgtcggcaacaaccagaacgcggtgcgggcgctg
ctggcgtcctatcaccgcatcgacgagtcgcagaccgccgacgggctgtggctggaggcc
accgcggccaagcaatttcgcaccagcggcgataccatcgccgccaaccgcgaggccgtg
ctgcagcgcggccgggcgcaggtgcgttag

DBGET integrated database retrieval system