KEGG   Mycobacterium canettii CIPT 140070008: BN43_40569Help
Entry
BN43_40569        CDS       T02420                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mcv00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3223095..3224336)
Genome map
AA seq 413 aa AA seqDB search
MTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYRGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTG
ARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVV
VHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQ
WAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAGRHASTLERS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaactcgaccgacgggcgcgctgacggccggttgcgggtggtggtgctgggcagt
accggctcgatcggcacccaggcgcttcaggtcatcgccgacaatccggaccgtttcgag
gtagtcgggctggccgctggcggcgcccatctggacacgttgctgcgacaacgtgcgcag
accggggtgaccaatattgccgtcgctgacgagcacgcggcgcagcgggtcggcgacatc
ccctaccgcggatccgacgccgccacccggctggtcgagcagaccgaggccgacgtcgtc
ctcaatgcgctggtcggcgcgttgggcctgcgaccgacgttggccgcgctcaagacgggt
gcccggctggcgctggccaacaaggaatcgttggtcgccggtggttcgctggtgctgcgg
gcggcgcggcccggtcagatcgtgccggtcgactccgaacactccgcgctggcccagtgc
ctgcgcggcggcactcccgacgaggtcgccaagctggtgctgacggcctcgggagggccg
tttcggggctggtccgcggccgacctcgagcatgtcacccccgagcaggccggcgcgcat
cctacgtggtcgatgggcccgatgaacacgctgaattcggcgtcgctggtcaacaaggga
cttgaggtcatcgaaacccacctgctgttcggcatcccctacgaccgcatcgatgtcgtg
gtgcacccccagtcgatcatccattcgatggtcaccttcatcgacggttcgacgatcgcc
caggccagtcccccggacatgaagctaccgatttcgttagcgctgggctggccgcgtcgg
gtcagcggcgccgctgctgcctgtgatttccataccgcgtcgagctgggagttcgagccg
ttggacaccgacgtcttccccgcggtcgagttggcccggcaggccggcgtagccggtggc
tgcatgaccgcggtttacaatgcggcgaacgaagaagcagcagcggcgttccttgctggc
cggatcggcttcccggccatcgtcggcatcatcgccgacgtgttgcacgctgccgaccaa
tgggccgtcgaacccgctaccgtggatgacgtactcgacgcgcagcgctgggcccgcgag
cgagcgcagcgcgcggtatctggtatggcttcggtggcgatcgcaagcacggcgaagccg
ggcgcagcgggtcgacacgcatcgacgttagaaaggtcctga

DBGET integrated database retrieval system