KEGG   Mycobacterium canettii CIPT 140070008: BN43_60010Help
Entry
BN43_60010        CDS       T02420                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3426139..3427719
Genome map
AA seq 526 aa AA seqDB search
MNTSASPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQVLAALADENRH
RLITLGMTPVVNAQLDDPYCLNGVHHWLANWQLRAEEAASVRYARQSKSADYPSCTPEAL
RAFGIRECADAARALDNFATRWRHGGSPLLRGLIDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAQLRLAHRPKGIWAPECAYAPGMEVDYATAGVSHFMVDGPSLHGDTALGRP
VGKTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEQKA
PYDPERADRAVDVHVADFVDVVRNRLLCESERIGRPAHVIAAFDTELFGHWWYEGPTWLQ
RVLRALPAAGVRVGTLSDAIADGFVGDPVELPPSSWGSGKDWQVWSGAKVADLVQLNSEV
VDTALTTIDKALAQTASLDGPLPRDHVADQILRETLLTVSSDWPFMVSKDSAADYARYRA
HLHAHATREIAGALAAGRRDTARRLAEGWNRADGLFGALDARRLPK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacgtccgcaagcccggtgcccggcctgttcacgcttgttctgcacactcacctg
ccctggctggcccaccacgggcgctggccggtcggcgaggaatggctctatcagtcgtgg
gcggcggcctacctgccgctgctgcaggtgctggccgcgctggccgacgagaaccggcac
cggttgatcaccctcgggatgacgccggtggtcaacgcccagctcgacgacccatactgc
ctaaacggtgtgcatcactggctagccaactggcagctgcgcgccgaagaggccgccagc
gtgcggtatgcccgtcagtcgaagtcggctgactatccgtcatgcacaccggaggcgttg
cgggcctttgggattcgcgaatgtgccgatgcagctcgcgcgctcgacaacttcgccacg
cggtggcggcacggcggcagcccgctgctgcgcggcctgatcgacgccggcacggtggag
ctgctcggtggcccacttgcccacccgttccagccgctgctggcaccgcggctgcgcgag
ttcgcgctgcgcgaaggcctcgccgatgctcagctgcggctggcgcaccgcccgaaaggg
atctgggcacccgaatgcgcgtacgccccagggatggaggtcgactacgctaccgcgggg
gtcagtcacttcatggtcgacggcccgtcgctgcacggcgacaccgcgctgggccggccg
gtggggaaaaccgatgtggtcgccttcggtcgcgacttgcaggtcagctaccgggtgtgg
tcaccgaaatccggctaccccgggcacgccgcctaccgcgacttccacacctacgaccac
ctgaccggactcaaaccggccagggtcaccgggcgtaacgtgccgtcggagcaaaaggca
ccctacgatcccgagcgcgctgaccgcgccgtcgacgtccatgttgccgatttcgtcgac
gtggtgcgcaatcggctgctctgtgagtccgagcgcatcggccggcccgcccacgtgatc
gccgccttcgacaccgagttgttcggccactggtggtacgagggcccaacctggctgcaa
cgggtattgcgggctttacccgccgccggtgtccgggtgggcaccctgagcgatgcgatc
gccgacggattcgtcggcgacccggtcgaattgccacccagctcttggggttccggcaag
gactggcaggtgtggagcggtgccaaggtggccgatctggtccagctcaacagcgaagtg
gtcgataccgcgttgaccaccatcgacaaggcgctggcccagacggcgtccctggacgga
ccgctgcctcgcgatcacgttgctgatcagatcctgcgcgagaccctgctcaccgtgtcc
agcgactggccgttcatggtgagcaaggactccgccgccgactacgcccgctatcgtgct
cacctgcacgcacacgccacccgggagatcgccggcgcgctggccgcgggccgacgcgac
accgcacggcggctcgccgaagggtggaaccgcgccgacggtctgttcggcgccctggac
gctcggaggctgcccaagtga

DBGET integrated database retrieval system