KEGG   Mycobacterium canettii CIPT 140070008: BN43_90016Help
Entry
BN43_90016        CDS       T02420                                 

Gene name
ltp
Definition
(GenBank) Putative lipid carrier protein or Keto acyl-CoA thiolase Ltp3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN43_90016 (ltp)
   00630 Glyoxylate and dicarboxylate metabolism
    BN43_90016 (ltp)
   00640 Propanoate metabolism
    BN43_90016 (ltp)
   00650 Butanoate metabolism
    BN43_90016 (ltp)
  Lipid metabolism
   00071 Fatty acid degradation
    BN43_90016 (ltp)
   00072 Synthesis and degradation of ketone bodies
    BN43_90016 (ltp)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN43_90016 (ltp)
   00310 Lysine degradation
    BN43_90016 (ltp)
   00380 Tryptophan metabolism
    BN43_90016 (ltp)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN43_90016 (ltp)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN43_90016 (ltp)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN43_90016 (ltp)
Enzymes [BR:mcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN43_90016 (ltp)
Exosome [BR:mcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN43_90016 (ltp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3971250..3972434
Genome map
AA seq 394 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIAETRLAQGHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITRPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctattcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggtcgtcgtcggcgac
gaggagatcgccgagacgcgcttggcgcaagggcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccaggcccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgattcaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system