KEGG   Mycobacterium canettii CIPT 140070008: BN43_90202Help
Entry
BN43_90202        CDS       T02420                                 

Gene name
glpK
Definition
Putative glycerol kinase GlpK (ATP:glycerol 3-phosphotransferase)(glycerokinase) (GK) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mcv  Mycobacterium canettii CIPT 140070008
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BN43_90202 (glpK)
Enzymes [BR:mcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BN43_90202 (glpK)
Exosome [BR:mcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN43_90202 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4149268..4150821)
Genome map
AA seq 517 aa AA seqDB search
MSDAILGEQLAESSDFIAAIDQGTTSTRCMIFDHHGAEVARHQLEHEQILPRAGWVEHNP
VEIWERTASVLISVLNATNLSPKDIAALGITNQRETTLVWNRHTGRPYYNAIVWQDTRTD
RIASALDRDGRGNLIRRKAGLPPATYFSGGKLQWILENVDGVRAAAENGDALFGTPDTWV
LWNLTGGPRGGVHVTDVTNASRTMLMDLETLDWDDELLSFFSIPRAMLPEIASSAPSEPY
GVTLATGPVGGEVPITGVLGDQHAAMVGQVCLAPGEAKNTYGTGNFLLLNTGETIVRSNN
GLLTTVCYQFGNAKPVYALEGSIAVTGSAVQWLRDQLGIISGAAQSEALARQVPDNGGMY
FVPAFSGLFAPYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVRL
QVLKVDGGITGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWAAPSDLRAN
WREDKRWTPTWDDDERAAGYAGWRKAVQRTLDWVDVS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgccatcctaggagagcaattggccgagtcctcggatttcatagccgccatc
gaccagggcaccaccagcacccgctgcatgatcttcgatcaccacggtgccgaggtggcc
cgccaccagctcgagcacgagcagatcctgccccgggccggctgggtggagcacaacccg
gtcgagatctgggagcgcaccgcgtcggtgttgatctcggtgctcaacgccaccaaccta
tcgccgaaagatattgccgcgttggggattaccaaccagcgtgagacgacgctggtatgg
aatcggcacaccggacggccctactacaacgcgatcgtatggcaggatacccgcaccgac
cgcatcgcgtcggcgctggatcgagacggtcgtggaaacctgatccgccgcaaggcgggc
ctgccgccggcaacatatttctctggcggcaagctgcagtggatcctggaaaatgtcgat
ggagtccgcgcggccgccgagaacggcgacgcattgttcggcacaccggacacctgggtg
ttgtggaatctgaccggcgggccgcgggggggtgtgcatgtcaccgatgtaaccaacgcc
agccggaccatgttgatggatctagagacgctggactgggacgacgagctgttgtcgttt
ttttcgatacctcgggccatgctgcccgagatcgcatcgtcggcgccgtcggagccttac
ggtgtcacgctggcgaccgggcctgtcggcggtgaggtgccgatcaccggagttctcggt
gatcagcatgcggccatggtcggtcaagtctgtctggccccaggggaggcgaaaaacacc
tatgggaccggcaattttctgctgctgaacaccggtgaaacgatcgtgcgatcgaataac
ggcctgctaaccacggtgtgctaccaattcgggaacgctaaacccgtgtacgcgcttgaa
ggttcgatcgcggtgaccggctcggcggtgcagtggctacgcgatcagctgggcatcatc
agcggcgccgcacagagtgaggcgctggcccgccaggtccccgacaacggcggcatgtat
ttcgtgccggcgttttccgggctgttcgcgccatactggcggtccgatgcgcgcggcgcg
atcgtcgggttgtcgcggttcaacaccaacgcgcacctggcgcgcgcaacgctggaggcg
atctgctaccagagccgcgatgtggtggacgccatggaagcagactccggtgttcgcctg
caggtgttgaaggtggatggcgggatcaccggcaacgacctgtgtatgcagatccaggcc
gacgtgttgggtgtggatgtggtgcggccggtggtcgccgagaccaccgcactaggtgcg
gcctacgcggcgggcttggcggtcgggttctgggcggctccgtccgatctgcgggccaac
tggcgagaggacaagcggtggacaccgacgtgggacgacgacgagcgtgccgcgggctat
gccggctggcgcaaggcggtgcagcggaccctggattgggttgacgtgtcctag

DBGET integrated database retrieval system